Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G20870 59 / 4e-12 HSP20-like chaperones superfamily protein (.1) AT1G76440 52 / 4e-10 HSP20-like chaperones superfamily protein (.1.2.3) AT1G54840 50 / 8e-09 HSP20-like chaperones superfamily protein (.1.2) AT1G54850 45 / 5e-07 HSP20-like chaperones superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030721 [exp] 124 / 8e-38 AT1G20870 69 / 4e-14 HSP20-like chaperones superfamily protein (.1) Lus10018368 [exp] 38 / 0.0001 AT1G20870 150 / 9e-42 HSP20-like chaperones superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G243100 [exp] 61 / 1e-13 AT1G76440 153 / 9e-49 HSP20-like chaperones superfamily protein (.1.2.3) Potri.002G005400 [exp] 52 / 2e-09 AT1G20870 179 / 1e-51 HSP20-like chaperones superfamily protein (.1) Potri.013G024750 [exp] 50 / 9e-09 AT1G54850 187 / 1e-57 HSP20-like chaperones superfamily protein (.1) Potri.013G024900 [exp] 43 / 2e-06 AT1G54850 175 / 6e-52 HSP20-like chaperones superfamily protein (.1) Potri.013G024600 [exp] 43 / 3e-06 AT1G54850 216 / 2e-71 HSP20-like chaperones superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10013203 pacid=23166625 polypeptide=Lus10013203 locus=Lus10013203.g ID=Lus10013203.BGIv1.0 annot-version=v1.0 ATGCCTTGCTCAGATTTTCTGAGTAGCTTCCCTGGAGAATTCCAGCTAAGGGTTCAGGATCTCAGCCCCAGTGGGGCGTTTCGGATTTGCTTCAAGCTGC CTGGACCTGTCGAACCACGACTCTTTTCTCCTAGCTATCGTGATGGGATACTTGAAGGGGTTGTGATGAAATGTCGAATGCCAAGTGCAGCACCACCTGC TCCCCAGCAAACAGCCTGA
AA sequence Show only first row Show all	>Lus10013203 pacid=23166625 polypeptide=Lus10013203 locus=Lus10013203.g ID=Lus10013203.BGIv1.0 annot-version=v1.0 MPCSDFLSSFPGEFQLRVQDLSPSGAFRICFKLPGPVEPRLFSPSYRDGILEGVVMKCRMPSAAPPAPQQTA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G20870			HSP20-like chaperones superfam...		Lus10013203 [exp]	0	1
AT5G51520			Plant invertase/pectin methyle...		Lus10031712 [exp]	7.9	0.8761
AT3G60480			unknown protein		Lus10000560 [exp]	8.7	0.8350
AT4G10490			2-oxoglutarate (2OG) and Fe(II...		Lus10031150 [exp]	16.2	0.8712
AT3G50280			HXXXD-type acyl-transferase fa...		Lus10031149 [exp]	16.7	0.8727
AT2G34560			P-loop containing nucleoside t...		Lus10023310 [exp]	19.4	0.8627
					Lus10025731 [exp]	20.4	0.8609
AT1G05010		ACO4, EAT1, EFE	ethylene forming enzyme, ethyl...		Lus10015153 [exp]	21.5	0.8590
AT1G75240	ZF_HD	ATHB33, ZHD5	zinc-finger homeodomain 5, hom...		Lus10031885 [exp]	23.0	0.8587
AT4G09720		AtRABG3a	RAB GTPase homolog G3A (.1.2.3...		Lus10006059 [exp]	27.4	0.8466
AT5G50790		SWEET10, AtSWEE...	Nodulin MtN3 family protein (....		Lus10032553 [exp]	27.5	0.8340

Compare expression of checked genes

Lus10013203 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.