Lus10013204 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G20850 509 / 0 XCP2 xylem cysteine peptidase 2 (.1)
AT4G35350 501 / 2e-179 XCP1 xylem cysteine peptidase 1 (.1.2)
AT5G43060 364 / 6e-124 Granulin repeat cysteine protease family protein (.1)
AT1G47128 358 / 1e-121 RD21A, RD21 RESPONSIVE TO DEHYDRATION 21A, responsive to dehydration 21, Granulin repeat cysteine protease family protein (.1)
AT5G50260 345 / 1e-117 CEP1 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1)
AT3G19390 345 / 9e-117 Granulin repeat cysteine protease family protein (.1)
AT1G09850 332 / 9e-112 XBCP3 xylem bark cysteine peptidase 3 (.1)
AT3G48340 330 / 9e-112 CEP2 cysteine endopeptidase 2, Cysteine proteinases superfamily protein (.1)
AT4G36880 330 / 1e-111 CP1 cysteine proteinase1 (.1)
AT4G11310 325 / 1e-109 RD21A, RD21 Papain family cysteine protease (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030722 694 / 0 AT4G35350 511 / 0.0 xylem cysteine peptidase 1 (.1.2)
Lus10033040 358 / 9e-123 AT5G50260 555 / 0.0 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1)
Lus10013674 356 / 6e-122 AT5G50260 554 / 0.0 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1)
Lus10024801 357 / 7e-121 AT1G47128 633 / 0.0 RESPONSIVE TO DEHYDRATION 21A, responsive to dehydration 21, Granulin repeat cysteine protease family protein (.1)
Lus10042078 349 / 3e-119 AT5G50260 538 / 0.0 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1)
Lus10018083 348 / 5e-119 AT5G50260 533 / 0.0 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1)
Lus10002827 347 / 5e-117 AT1G47128 609 / 0.0 RESPONSIVE TO DEHYDRATION 21A, responsive to dehydration 21, Granulin repeat cysteine protease family protein (.1)
Lus10027877 347 / 8e-117 AT5G43060 597 / 0.0 Granulin repeat cysteine protease family protein (.1)
Lus10032406 340 / 6e-116 AT5G45890 391 / 2e-136 senescence-associated gene 12 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G256000 542 / 0 AT1G20850 539 / 0.0 xylem cysteine peptidase 2 (.1)
Potri.002G005700 530 / 0 AT1G20850 531 / 0.0 xylem cysteine peptidase 2 (.1)
Potri.004G207600 511 / 0 AT4G35350 543 / 0.0 xylem cysteine peptidase 1 (.1.2)
Potri.014G024100 366 / 1e-124 AT5G43060 646 / 0.0 Granulin repeat cysteine protease family protein (.1)
Potri.007G047600 359 / 5e-123 AT5G43060 461 / 9e-162 Granulin repeat cysteine protease family protein (.1)
Potri.012G090900 358 / 9e-123 AT5G50260 561 / 0.0 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1)
Potri.001G302100 355 / 6e-120 AT1G47128 598 / 0.0 RESPONSIVE TO DEHYDRATION 21A, responsive to dehydration 21, Granulin repeat cysteine protease family protein (.1)
Potri.009G098100 352 / 4e-119 AT1G47128 607 / 0.0 RESPONSIVE TO DEHYDRATION 21A, responsive to dehydration 21, Granulin repeat cysteine protease family protein (.1)
Potri.015G087400 346 / 5e-118 AT5G50260 550 / 0.0 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1)
Potri.004G056258 343 / 4e-117 AT5G45890 417 / 8e-147 senescence-associated gene 12 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0125 Peptidase_CA PF00112 Peptidase_C1 Papain family cysteine protease
CL0125 PF08246 Inhibitor_I29 Cathepsin propeptide inhibitor domain (I29)
Representative CDS sequence
>Lus10013204 pacid=23166622 polypeptide=Lus10013204 locus=Lus10013204.g ID=Lus10013204.BGIv1.0 annot-version=v1.0
ATGGCCTCCAACAACACACTCTTCCTCTTCCTCTTCCTTGCTATGGCCACCCTCATTGGCGTCTCGGCCCGCGACTTCTCCATAGTGGGCTACTCCGACG
ACGACTTGACATCCACCGATAAGATGGTGGACCTGTTCGAGTCGTGGATGGACAAGCACGGCAAAATGTACGAGACCATCGAGGAGAAGCTCAAAAGGTT
CGACATCTTCAAGGACAACCTCTTCCACATCGACGAGACCAACAAGAAGGTCACCAACTATTGGCTAGGACTCAATGAGTTCGCTGACTTGAGCCACCAC
GAGTTCAAGAGCATGTACCTTGGCCTCAAACCTCCCACCACTTTGACAAGAAGGGAGTCAAATGTAGAGGAGTATGAGGCGGTTGAGAGTAATGTTCCCA
AGGCGGTGGACTGGAGGAAGAAGGGAGCCGTGACTCCGGTCAAGAACCAAGGCTCGTGCGGAAGTTGTTGGGCATTCTCCACAGTTGCAGCCGTCGAAGG
AATCAACCAGATCGTTACGGGGAACCTGACTTCCCTTTCGGAGCAGGAGCTTATTGATTGTGACAAGGGTACTTACAACAATGGTTGCAATGGTGGTCTT
ATGGACTATGCTTTTGCTTACATTGCTTCCAATGGTGGACTTCACAAGGAGGAGGATTACCCTTACATCATGGAAGAGGGCACCTGCGAGATGACCAAAG
ACGTGGACTCGGAAGTGGTAACGATTAGCGGGTACAAGGATGTGCCGTCGAACAACGAGCAGAGTCTGATCAAGGCGTTGGCTAAGCAGCCATTGAGTGT
GGCCATTGATGCATCTGGGAGGGAGTTCCAATTCTACAGTGGGGGAGTGTTCGACGGGAAGTGCGGGACAAGTCTGGACCATGGGGTGGCAGCGGTTGGC
TACGGGTCGAGCGGGAAAGGGAACGACTTCATCGTTGTGAAGAACTCGTGGGGGACCAAATGGGGAGAACAAGGCTACATCAGGATGAAGAGGAACACCG
GCAAGGCTGAAGGTCTTTGTGGCATCAACAAGATGGCTTCCTATCCTACTAAATCCAAATGA
AA sequence
>Lus10013204 pacid=23166622 polypeptide=Lus10013204 locus=Lus10013204.g ID=Lus10013204.BGIv1.0 annot-version=v1.0
MASNNTLFLFLFLAMATLIGVSARDFSIVGYSDDDLTSTDKMVDLFESWMDKHGKMYETIEEKLKRFDIFKDNLFHIDETNKKVTNYWLGLNEFADLSHH
EFKSMYLGLKPPTTLTRRESNVEEYEAVESNVPKAVDWRKKGAVTPVKNQGSCGSCWAFSTVAAVEGINQIVTGNLTSLSEQELIDCDKGTYNNGCNGGL
MDYAFAYIASNGGLHKEEDYPYIMEEGTCEMTKDVDSEVVTISGYKDVPSNNEQSLIKALAKQPLSVAIDASGREFQFYSGGVFDGKCGTSLDHGVAAVG
YGSSGKGNDFIVVKNSWGTKWGEQGYIRMKRNTGKAEGLCGINKMASYPTKSK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G20850 XCP2 xylem cysteine peptidase 2 (.1... Lus10013204 0 1
AT1G10460 GLP7 germin-like protein 7 (.1) Lus10010726 1.4 0.9953
AT5G61750 RmlC-like cupins superfamily p... Lus10022071 1.4 0.9946
AT3G45010 SCPL48 serine carboxypeptidase-like 4... Lus10041339 1.7 0.9932
AT1G12260 NAC ANAC007, VND4, ... VASCULAR RELATED NAC-DOMAIN PR... Lus10031721 2.2 0.9908
AT1G10460 GLP7 germin-like protein 7 (.1) Lus10029214 2.8 0.9920
AT1G43790 TED6 tracheary element differentiat... Lus10018925 5.3 0.9893
AT1G10800 unknown protein Lus10041270 6.0 0.9875
AT3G62160 HXXXD-type acyl-transferase fa... Lus10004527 6.9 0.9889
AT4G35350 XCP1 xylem cysteine peptidase 1 (.1... Lus10030722 6.9 0.9897
AT4G18425 Protein of unknown function (D... Lus10015394 6.9 0.9543

Lus10013204 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.