Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030724 [exp] 77 / 5e-21 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G255701 [exp] 50 / 3e-10 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10013206 pacid=23166678 polypeptide=Lus10013206 locus=Lus10013206.g ID=Lus10013206.BGIv1.0 annot-version=v1.0 ATGTCGTTCATGAGGGGAGAGCCTTTGTTTTCCAAGCTGTCAGCTTTATCTCAATACGTGGTTTTTCCGGGAGCCATGATCGCCGCTCTCATCTATTCTC CTCCGCGCTACGGATCCTCGTCTTCATCCTCCTCCTCCAACACTGCCAATTCCTCTAAATAG
AA sequence Show only first row Show all	>Lus10013206 pacid=23166678 polypeptide=Lus10013206 locus=Lus10013206.g ID=Lus10013206.BGIv1.0 annot-version=v1.0 MSFMRGEPLFSKLSALSQYVVFPGAMIAALIYSPPRYGSSSSSSSSNTANSSK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10013206 [exp]	0	1
AT3G47160			RING/U-box superfamily protein...		Lus10006447 [exp]	2.2	0.8818
AT1G77370			Glutaredoxin family protein (....		Lus10028355 [exp]	6.5	0.8511
AT5G63910		FCLY	farnesylcysteine lyase (.1)		Lus10010948 [exp]	9.6	0.8372
AT3G47160			RING/U-box superfamily protein...		Lus10011390 [exp]	9.7	0.8312
AT5G45130		ATRAB-F2A, RHA1...	ARABIDOPSIS RAB HOMOLOG F2A, R...		Lus10040625 [exp]	15.6	0.8473
AT3G04530		ATPPCK2, PEPCK2...	phosphoenolpyruvate carboxylas...		Lus10021190 [exp]	20.3	0.8076
AT1G24450		NFD2	NUCLEAR FUSION DEFECTIVE 2, Ri...		Lus10042133 [exp]	24.7	0.8068
AT3G60600		(AT)VAP, (AT)VA...	VAMP/SYNAPTOBREVIN-ASSOCIATED ...		Lus10028937 [exp]	25.9	0.8044
AT3G14280			unknown protein		Lus10037453 [exp]	26.1	0.8060
AT4G17790			SNARE associated Golgi protein...		Lus10000905 [exp]	28.1	0.8194

Compare expression of checked genes

Lus10013206 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.