Lus10013214 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G42480 105 / 7e-30 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030732 131 / 9e-40 AT1G42480 210 / 4e-70 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G253600 112 / 3e-32 AT1G42480 201 / 2e-66 unknown protein
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF11938 DUF3456 TLR4 regulator and MIR-interacting MSAP
Representative CDS sequence
>Lus10013214 pacid=23166676 polypeptide=Lus10013214 locus=Lus10013214.g ID=Lus10013214.BGIv1.0 annot-version=v1.0
ATGGCGTTGCTGGTGCCGGCCGTTTTGCTCCTCCTTACAATCACGGCGGTTTCCGCCGCCGACAACAAATGCGGCGCTTGCAATGCTGTTGCGGAAAAGC
CGAAGAATCATCTTGATATGAGATATCGCCTAGACTCTAAAGGCCAACGCGAAGGGAAGGTAATCGATTACAGAGTCAGCGATCTGAGAGTTGTTGAACT
GTTGGATGGGCTTTGCGACAAGATGCAGAGTTATACACTTGAGAAAACAAGCAAGAAGCTCGTGCGTATGCAAAAGAGATGTCATCCTATTGTGGAAGGT
AAGGTGGAACGGGGTCCTTTCATTTCCTCTTTCTTCCTTATCATTGCAACTTTACTACTGAGCTGCTGTTATGATTTTTTCGGTCCAAAGACATTGAATC
AAGTTGCTTAA
AA sequence
>Lus10013214 pacid=23166676 polypeptide=Lus10013214 locus=Lus10013214.g ID=Lus10013214.BGIv1.0 annot-version=v1.0
MALLVPAVLLLLTITAVSAADNKCGACNAVAEKPKNHLDMRYRLDSKGQREGKVIDYRVSDLRVVELLDGLCDKMQSYTLEKTSKKLVRMQKRCHPIVEG
KVERGPFISSFFLIIATLLLSCCYDFFGPKTLNQVA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G42480 unknown protein Lus10013214 0 1
AT1G64940 CYP89A6 "cytochrome P450, family 87, s... Lus10020358 1.7 0.5998
AT1G13560 AAPT1, ATAAPT1 aminoalcoholphosphotransferase... Lus10002042 7.3 0.5455
AT2G34930 disease resistance family prot... Lus10016326 19.0 0.4674
AT2G24190 SDR2 short-chain dehydrogenase/redu... Lus10008413 21.9 0.5169
Lus10010518 29.5 0.4605
AT1G27170 transmembrane receptors;ATP bi... Lus10008414 38.4 0.4782
AT5G14180 MPL1 Myzus persicae-induced lipase ... Lus10035218 93.6 0.4328
Lus10001379 111.3 0.4295
AT4G02210 unknown protein Lus10032996 114.7 0.4034
AT3G18990 B3 REM39, VRN1 REDUCED VERNALIZATION RESPONSE... Lus10000746 115.7 0.4295

Lus10013214 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.