Lus10013228 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G20575 418 / 5e-150 DPMS1 dolichol phosphate mannose synthase 1, Nucleotide-diphospho-sugar transferases superfamily protein (.1)
AT2G39630 58 / 9e-10 Nucleotide-diphospho-sugar transferases superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030748 454 / 2e-164 AT1G20575 450 / 9e-163 dolichol phosphate mannose synthase 1, Nucleotide-diphospho-sugar transferases superfamily protein (.1)
Lus10023414 56 / 7e-09 AT2G39630 504 / 0.0 Nucleotide-diphospho-sugar transferases superfamily protein (.1.2)
Lus10040296 55 / 1e-08 AT2G39630 476 / 3e-170 Nucleotide-diphospho-sugar transferases superfamily protein (.1.2)
Lus10005164 46 / 1e-05 AT2G39630 387 / 2e-131 Nucleotide-diphospho-sugar transferases superfamily protein (.1.2)
Lus10001691 44 / 7e-05 AT2G39630 479 / 3e-171 Nucleotide-diphospho-sugar transferases superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G010300 418 / 4e-150 AT1G20575 452 / 1e-163 dolichol phosphate mannose synthase 1, Nucleotide-diphospho-sugar transferases superfamily protein (.1)
Potri.005G250900 416 / 2e-149 AT1G20575 447 / 6e-162 dolichol phosphate mannose synthase 1, Nucleotide-diphospho-sugar transferases superfamily protein (.1)
Potri.008G055700 52 / 1e-07 AT2G39630 499 / 5e-179 Nucleotide-diphospho-sugar transferases superfamily protein (.1.2)
Potri.010G204000 50 / 4e-07 AT2G39630 509 / 0.0 Nucleotide-diphospho-sugar transferases superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0110 GT-A PF00535 Glycos_transf_2 Glycosyl transferase family 2
Representative CDS sequence
>Lus10013228 pacid=23166637 polypeptide=Lus10013228 locus=Lus10013228.g ID=Lus10013228.BGIv1.0 annot-version=v1.0
ATGGCGGAGGAAGAGTGGAAGAACGAAGGGAAGAACAAGTACAGCATAATTATCCCTACATACAACGAGCGTCTCAACATCGCCATCATCGTTTACCTCA
TTTTCAAGCATCTCCGGGATATCGATTTTGAAATTATAGTTGTGGATGATGGAAGCCCCGACGGCACTCAAGATATTGTCAAGCAGTTGCAGCAAGTGTA
TGGCGAAGACCGTGTTTTATTAAGAGCTAGACCGAAAAAGCTTGGTCTTGGCACGGCTTACGTTCATGGATTGAAGCATGCGTCTGGCAATTTTGTAGTA
ATAATGGATGCTGATCTATCCCACCATCCAAAGTACCTGCCGAGCTTTATCAAGAAACAGTTGGAGACCAGTGCAAGTATCGTTACAGGAACCAGATATG
TTACAGGTGGTGGTGTCCATGGTTGGAGTCTTATGCGGAAACTAACCAGCAGAGGAGCCAATGTCCTGGCTCAAACGTTCTTATGGCCTGGTGTCTCCGA
CTTGACAGGATCTTTCCGGCTTTACAAGAAATCCGTGCTCGAAGACATCATAGCTTCAGTTGTTAGCAAAGGCTACGTATTTCAGATGGAAATGATAGTT
CGTGCTTCCAGAAAAGGATACCGTATCGAGGAGGTACCGATTACATTCGTTGACCGCGTATTTGGAAGCTCGAAACTTGGAGGATCGGAAATTGTAGAAT
ACCTGAAAGGCCTAGCTTATCTGCTGGTTACAACTTAG
AA sequence
>Lus10013228 pacid=23166637 polypeptide=Lus10013228 locus=Lus10013228.g ID=Lus10013228.BGIv1.0 annot-version=v1.0
MAEEEWKNEGKNKYSIIIPTYNERLNIAIIVYLIFKHLRDIDFEIIVVDDGSPDGTQDIVKQLQQVYGEDRVLLRARPKKLGLGTAYVHGLKHASGNFVV
IMDADLSHHPKYLPSFIKKQLETSASIVTGTRYVTGGGVHGWSLMRKLTSRGANVLAQTFLWPGVSDLTGSFRLYKKSVLEDIIASVVSKGYVFQMEMIV
RASRKGYRIEEVPITFVDRVFGSSKLGGSEIVEYLKGLAYLLVTT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G20575 DPMS1 dolichol phosphate mannose syn... Lus10013228 0 1
AT1G28410 unknown protein Lus10015403 1.0 0.9078
AT3G51610 NPU NO PRIMEXINE AND PLASMA MEMBRA... Lus10006096 3.2 0.8653
AT5G47550 Cystatin/monellin superfamily ... Lus10010495 6.3 0.8872
AT1G11780 oxidoreductase, 2OG-Fe(II) oxy... Lus10015782 13.9 0.8750
AT1G61770 Chaperone DnaJ-domain superfam... Lus10006760 14.1 0.8112
AT1G24050 RNA-processing, Lsm domain (.1... Lus10010705 14.7 0.8701
AT4G27750 ISI1 IMPAIRED SUCROSE INDUCTION 1, ... Lus10017985 15.0 0.8509
AT4G18260 Cytochrome b561/ferric reducta... Lus10028131 18.7 0.8411
AT5G51700 ATRAR1, RPR2, P... Required for Mla12 resistance ... Lus10031107 18.7 0.8766
AT1G23440 Peptidase C15, pyroglutamyl pe... Lus10029137 19.2 0.8861

Lus10013228 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.