Gene [FLAX] | FIBexDB

Lus10013257 [FLAX]

External link

Symbol

Arabidopsis homologues

Show only best Show top 10

Locus ID	BLAST score/e-value	Alias	TAIR10 short description
AT4G23300	50 / 9e-08	CRK22	cysteine-rich RLK (RECEPTOR-like protein kinase) 22 (.1)
AT4G23210	47 / 6e-07	HIG1, CRK13	cysteine-rich RLK (RECEPTOR-like protein kinase) 13 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 13 (.2), cysteine-rich RLK (RECEPTOR-like protein kinase) 13 (.3)
AT5G41290	39 / 0.0004		Receptor-like protein kinase-related family protein (.1)

Paralogs

Show only best Show top 10

Gene ID	BLAST score/e-value	At best hit	BLAST score/e-value	TAIR10 short description
Lus10030782 [exp]	109 / 1e-31	ND	39 / 4e-04
Lus10034545 [exp]	92 / 1e-24	ND	/
Lus10034546 [exp]	86 / 2e-22	AT3G22060	43 / 1e-05	Receptor-like protein kinase-related family protein (.1)
Lus10030780 [exp]	86 / 3e-22	ND	36 / 0.004
Lus10030777 [exp]	86 / 5e-22	AT5G48540	39 / 8e-04	receptor-like protein kinase-related family protein (.1)
Lus10030781 [exp]	85 / 8e-22	ND	/
Lus10035197 [exp]	82 / 7e-21	ND	/
Lus10013255 [exp]	80 / 6e-20	ND	/
Lus10013260 [exp]	80 / 7e-20	ND	37 / 0.003

Poplar homologues

Show only best Show top 10

Locus ID	BLAST score/e-value	At best hit	BLAST score/e-value	TAIR10 short description
Potri.011G030400 [exp]	42 / 6e-05	AT4G38830	190 / 4e-56	cysteine-rich RLK (RECEPTOR-like protein kinase) 26 (.1)
Potri.011G029400 [exp]	42 / 6e-05	AT4G38830	190 / 4e-56	cysteine-rich RLK (RECEPTOR-like protein kinase) 26 (.1)
Potri.005G208400 [exp]	40 / 0.0002	AT5G48540	52 / 1e-08	receptor-like protein kinase-related family protein (.1)
Potri.011G028500 [exp]	39 / 0.0004	AT4G05200	160 / 4e-44	cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)

PFAM info

Clan ID	Clan name	Pfam ID	Pfam name	Pfam description
		PF01657 [flax] [poplar]	Stress-antifung	Salt stress response/antifungal

Representative CDS sequence

Show only first row Show all

>Lus10013257 pacid=23166629 polypeptide=Lus10013257 locus=Lus10013257.g ID=Lus10013257.BGIv1.0 annot-version=v1.0

ATGGAGTACTACTACAACTACAATTTCTCTTCTTCTTCCTCTTCTTTGAGTAAGAAACTGATGGCAATCGCAACAATACTGCTTACCCTATTTACTATCG

CCGTTTCCGACGAGCCATCCTGCGAAAAAAATAGGAAGCCTGTACTTTCTGGGCCTTGTATGGACGACTATGCTCAATGCGTAAGTATCGTGATCACAGC

GTTACAGGACCAGACTCCCCAATATGATAACTACTACTTTTACACGTCTTCCCCGAAAGGCTTCCCAATTCACGGGGTAAGTGGTGCCGCCACTTGCCCT

TCTACATCTACCCCCGCCGGCTGTAAGAGCTGCCTAATTGGCGCCCAAAGCTGGCTGGCCAAAGAATGTCCTAGCTCCATCGAAGGCTATTACTCTTCCG

GGGATTGTATGATGACTTACTCCCAAATCTAA

AA sequence

Show only first row Show all

>Lus10013257 pacid=23166629 polypeptide=Lus10013257 locus=Lus10013257.g ID=Lus10013257.BGIv1.0 annot-version=v1.0

MEYYYNYNFSSSSSSLSKKLMAIATILLTLFTIAVSDEPSCEKNRKPVLSGPCMDDYAQCVSIVITALQDQTPQYDNYYFYTSSPKGFPIHGVSGAATCP

STSTPAGCKSCLIGAQSWLAKECPSSIEGYYSSGDCMMTYSQI

DESeq2's median of ratios [FLAX]

Coexpressed genes

Download tab-delimited text

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G23300		CRK22	cysteine-rich RLK (RECEPTOR-li...		Lus10013257 [exp]	0	1

Lus10013257 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.