Lus10013259 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013258 111 / 7e-32 ND /
Lus10001790 91 / 5e-24 ND /
Lus10013260 81 / 3e-20 ND 37 / 0.003
Lus10030782 77 / 6e-19 ND 39 / 4e-04
Lus10032027 73 / 4e-17 ND /
Lus10035197 69 / 2e-15 ND /
Lus10034545 69 / 2e-15 ND /
Lus10013257 67 / 1e-14 AT4G23300 51 / 3e-08 cysteine-rich RLK (RECEPTOR-like protein kinase) 22 (.1)
Lus10030783 64 / 1e-13 ND 35 / 0.009
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10013259 pacid=23166686 polypeptide=Lus10013259 locus=Lus10013259.g ID=Lus10013259.BGIv1.0 annot-version=v1.0
ATGGAGTACATTTACAGCTACCCTTCATCTTCTTCTTTGAGTAAGAAACTCATGATCGTAATAACAACATTGATGCTGCTTATTGTTACTACACCGGTTG
CGACGGAGGACGAGCTATATTATTGCGGCGATGATGAGCCGTTTGGTTACGGTCCTTGTACAGATGAGGACAATTCATGTGCAACCAAAGTGCTCACGTA
TTTAAAGGACAACACGCCCTACAGCAGAGATTACAAGTTGGACGCATCTCACCCAAATGCATACGCAAGTGGCCGCTACGAGGGCCAGGCGAGTTGCGAG
TCTCGATTTTCCCTGGCCGACTGCCAGAGCTGCCTTAATGGCGCCAATAACTGGCTGACAACAATTTGCGTTTACGACTACTACCGCAACAGCGGAAATT
ACTCTTACGGTATTTGCCACATGTCTTTCGCGCAAATCTCCTGA
AA sequence
>Lus10013259 pacid=23166686 polypeptide=Lus10013259 locus=Lus10013259.g ID=Lus10013259.BGIv1.0 annot-version=v1.0
MEYIYSYPSSSSLSKKLMIVITTLMLLIVTTPVATEDELYYCGDDEPFGYGPCTDEDNSCATKVLTYLKDNTPYSRDYKLDASHPNAYASGRYEGQASCE
SRFSLADCQSCLNGANNWLTTICVYDYYRNSGNYSYGICHMSFAQIS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10013259 0 1
AT1G21430 YUC11 Flavin-binding monooxygenase f... Lus10000677 2.4 1.0000
AT2G15220 Plant basic secretory protein ... Lus10001608 3.5 1.0000
AT4G35580 NAC NTL9, CBNAC NAC transcription factor-like ... Lus10005144 4.2 1.0000
Lus10024141 4.9 1.0000
AT5G06720 ATPA2 peroxidase 2 (.1) Lus10027988 5.5 1.0000
Lus10013255 6.0 1.0000
AT1G61110 NAC ANAC025 NAC domain containing protein ... Lus10013964 7.0 1.0000
AT3G06240 F-box family protein (.1) Lus10014136 7.5 1.0000
Lus10028570 7.9 1.0000
AT2G47140 AtSDR5 short-chain dehydrogenase redu... Lus10029435 8.4 1.0000

Lus10013259 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.