Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G02760 304 / 6e-108 ATUBC2 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) AT1G14400 301 / 8e-107 ATUBC1, UBC1 UBIQUITIN CONJUGATING ENZYME 1, ubiquitin carrier protein 1 (.1.2) AT5G62540 277 / 2e-97 UBC3 ubiquitin-conjugating enzyme 3 (.1) AT4G27960 144 / 7e-45 UBC9 ubiquitin conjugating enzyme 9 (.1.2) AT1G64230 143 / 1e-44 UBC28 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) AT5G53300 143 / 2e-44 UBC10 ubiquitin-conjugating enzyme 10 (.1.2.3.4) AT5G41700 141 / 9e-44 ATUBC8, UBC8 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5) AT3G08690 139 / 4e-43 ATUBC11, UBC11 ubiquitin-conjugating enzyme 11 (.1.2) AT2G16740 139 / 5e-43 UBC29 ubiquitin-conjugating enzyme 29 (.1) AT5G56150 139 / 1e-42 UBC30 ubiquitin-conjugating enzyme 30 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030786 [exp] 312 / 2e-111 AT2G02760 305 / 2e-108 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Lus10036727 [exp] 310 / 2e-110 AT2G02760 310 / 1e-110 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Lus10037203 [exp] 310 / 2e-110 AT2G02760 310 / 1e-110 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Lus10027570 [exp] 144 / 1e-44 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10039323 [exp] 144 / 1e-44 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10014187 [exp] 144 / 1e-44 AT1G64230 303 / 7e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10022726 [exp] 144 / 1e-44 AT1G64230 303 / 7e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10038827 [exp] 144 / 1e-44 AT1G64230 301 / 3e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10014942 [exp] 144 / 1e-44 AT1G64230 301 / 3e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G064400 [exp] 308 / 1e-109 AT2G02760 313 / 1e-111 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Potri.019G039200 [exp] 306 / 8e-109 AT2G02760 285 / 2e-100 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Potri.015G064000 [exp] 303 / 1e-107 AT2G02760 284 / 3e-100 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Potri.003G136200 [exp] 143 / 1e-44 AT1G64230 304 / 4e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Potri.006G110200 [exp] 143 / 1e-44 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5) Potri.015G023300 [exp] 143 / 2e-44 AT5G53300 302 / 1e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4) Potri.012G033000 [exp] 143 / 2e-44 AT5G53300 302 / 1e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4) Potri.016G138900 [exp] 143 / 2e-44 AT1G64230 304 / 3e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Potri.001G094900 [exp] 143 / 2e-44 AT1G64230 302 / 2e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Potri.019G131400 [exp] 142 / 5e-44 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0208 [flax] [poplar] UBC PF00179 [flax] [poplar] UQ_con Ubiquitin-conjugating enzyme
Representative CDS sequence Show only first row Show all	>Lus10013263 pacid=23166611 polypeptide=Lus10013263 locus=Lus10013263.g ID=Lus10013263.BGIv1.0 annot-version=v1.0 ATGACAACTCCTTCAAGGAAGAGGTTGATGAGGGATTTTAAGAGGCTGCAACATGATCCTCCTGCTGGTATTAGTGGTGCTCCCCAAGACAACAACATCC TGCTGTGGAATGCTGTTATATTTGGGCCAGATGACACGCCATGGGATGGAGGCACGTTTAAGTTGACACTTCAGTTTACTGAAGACTATCCTAACAAGCC ACCAACCGTGCGCTTCGTCTCCAGAATGTTCCATCCAAATATCTATGCAGATGGGAGTATTTGCTTGGACATCCTTCAAAATCAATGGAGTCCTATTTAT GATGTGGCTGCAATACTCACATCAATCCAGTCTCTGCTTTGTGATCCAAATCCAAACTCTCCAGCCAATTCGGAAGCTGCAAGAATGTTCAGCGAGAACA AACGCGAGTACAACATGAGAGTGCGCGAGATTGTCGACCAGAGTTGGACTGCTGATTAA
AA sequence Show only first row Show all	>Lus10013263 pacid=23166611 polypeptide=Lus10013263 locus=Lus10013263.g ID=Lus10013263.BGIv1.0 annot-version=v1.0 MTTPSRKRLMRDFKRLQHDPPAGISGAPQDNNILLWNAVIFGPDDTPWDGGTFKLTLQFTEDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIY DVAAILTSIQSLLCDPNPNSPANSEAARMFSENKREYNMRVREIVDQSWTAD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G02760		ATUBC2	ubiquitin-conjugating enzyme 2...		Lus10013263 [exp]	0	1
AT5G48340			unknown protein		Lus10041085 [exp]	1.4	0.9529
AT4G32180		ATPANK2	pantothenate kinase 2 (.1.2.3)		Lus10013019 [exp]	2.2	0.9612
AT5G27450		MVK, MK	mevalonate kinase (.1.2.3)		Lus10015168 [exp]	4.5	0.9462
AT4G19420			Pectinacetylesterase family pr...		Lus10037269 [exp]	4.9	0.9454
AT2G26070		RTE1	REVERSION-TO-ETHYLENE SENSITIV...		Lus10030001 [exp]	5.9	0.9424
AT5G14250		CSN3, FUS11, CO...	FUSCA 11, COP9 SIGNALOSOME SUB...		Lus10014595 [exp]	7.0	0.9228
AT3G12300			unknown protein		Lus10005383 [exp]	7.1	0.9415
AT5G29000	GARP	PHL1	PHR1-like 1, Homeodomain-like ...		Lus10008197 [exp]	7.2	0.9385
AT4G16520		ATG8F	autophagy 8f, Ubiquitin-like s...		Lus10008507 [exp]	8.5	0.9347
AT3G16990			Haem oxygenase-like, multi-hel...		Lus10016885 [exp]	8.7	0.9346

Compare expression of checked genes

Lus10013263 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.