Lus10013266 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030789 145 / 7e-46 ND /
Lus10020770 99 / 2e-25 AT1G06530 147 / 6e-42 peroxisomal and mitochondrial division factor 2, Tropomyosin-related (.1)
Lus10007347 91 / 1e-22 AT3G58840 148 / 3e-42 peroxisomal and mitochondrial division factor 1, Tropomyosin-related (.1.2)
Lus10031394 70 / 5e-15 AT1G06530 130 / 1e-35 peroxisomal and mitochondrial division factor 2, Tropomyosin-related (.1)
Lus10010937 55 / 1e-09 AT3G58840 140 / 3e-39 peroxisomal and mitochondrial division factor 1, Tropomyosin-related (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G060200 52 / 2e-08 AT1G06530 91 / 5e-21 peroxisomal and mitochondrial division factor 2, Tropomyosin-related (.1)
Potri.005G201400 45 / 2e-06 AT1G06530 144 / 8e-41 peroxisomal and mitochondrial division factor 2, Tropomyosin-related (.1)
PFAM info
Representative CDS sequence
>Lus10013266 pacid=23166620 polypeptide=Lus10013266 locus=Lus10013266.g ID=Lus10013266.BGIv1.0 annot-version=v1.0
ATGAAGGTGAAACTGGAGGCGGCTAACGACAGGAAGGCCTATTCGGAGAAGAGATTGAGGGCGATGGAGAGGAATGCCGGGATTACTGAGAGAGATAAGG
AGTTGGTTGAATATAAGAGGATCGCGGACGAATTGGAGAAGGAGTTGGCTGTTCGATCTGAAATGGAGGAGAAGTTGATCGTCTCTGGAAAAAGGAACAG
AGAGATCGAAATGAAGATGGTGATGTTGCGGAAGAAGGCAGGGGAGTCTGAGAAGAGCATCGTTGAGATGAAACAGAGTGCTTTCGAAGTCGTTAATAAT
GGCTTCAATCTTGACCATGGTGAAGATAGAGATTTCAATTTGCAGTTGCCGGTGGTGGTAATCGTTGCAGCTGCAGTTGCCTATCTCTTCTACGCAAGGA
GACAGTGA
AA sequence
>Lus10013266 pacid=23166620 polypeptide=Lus10013266 locus=Lus10013266.g ID=Lus10013266.BGIv1.0 annot-version=v1.0
MKVKLEAANDRKAYSEKRLRAMERNAGITERDKELVEYKRIADELEKELAVRSEMEEKLIVSGKRNREIEMKMVMLRKKAGESEKSIVEMKQSAFEVVNN
GFNLDHGEDRDFNLQLPVVVIVAAAVAYLFYARRQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10013266 0 1
AT2G15220 Plant basic secretory protein ... Lus10013866 4.5 0.7665
Lus10041357 6.3 0.7927
AT3G50310 MKKK20, MAPKKK2... MAPKK kinase 20, mitogen-activ... Lus10026894 8.9 0.7910
AT3G07320 O-Glycosyl hydrolases family 1... Lus10038211 13.4 0.7569
AT3G07320 O-Glycosyl hydrolases family 1... Lus10025892 14.5 0.7771
AT3G27540 beta-1,4-N-acetylglucosaminylt... Lus10035231 25.5 0.7592
AT3G18930 RING/U-box superfamily protein... Lus10012033 29.3 0.7632
AT1G20510 OPCL1 OPC-8:0 CoA ligase1 (.1.2) Lus10038667 30.7 0.6778
AT4G11070 WRKY ATWRKY41, WRKY4... WRKY family transcription fact... Lus10032372 36.2 0.7599
AT4G11070 WRKY ATWRKY41, WRKY4... WRKY family transcription fact... Lus10023099 52.9 0.7456

Lus10013266 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.