Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G70060 44 / 1e-06 SNL4 SIN3-like 4 (.1) AT1G59890 43 / 4e-06 SNL5 SIN3-like 5 (.1.2.3.4) AT1G24190 41 / 1e-05 SNL3, AtSin3 ARABIDOPSIS THALIANA SIN3 HOMOLOG, SIN3-like 3 (.1.2) AT3G01320 40 / 6e-05 SNL1 SIN3-like 1 (.1.2) AT1G24200 37 / 0.0005 Paired amphipathic helix (PAH2) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030814 [exp] 125 / 2e-38 AT1G70060 130 / 2e-35 SIN3-like 4 (.1) Lus10030816 [exp] 49 / 1e-08 AT1G59890 140 / 8e-39 SIN3-like 5 (.1.2.3.4) Lus10030817 [exp] 47 / 1e-07 AT1G70060 1426 / 0.0 SIN3-like 4 (.1) Lus10013293 [exp] 46 / 3e-07 AT1G70060 1454 / 0.0 SIN3-like 4 (.1) Lus10032181 [exp] 46 / 4e-07 AT5G15020 1362 / 0.0 SIN3-like 2 (.1.2) Lus10014504 [exp] 45 / 4e-07 AT3G01320 897 / 0.0 SIN3-like 1 (.1.2) Lus10010729 [exp] 43 / 3e-06 AT1G70060 1191 / 0.0 SIN3-like 4 (.1) Lus10029218 [exp] 41 / 2e-05 AT1G24190 270 / 4e-81 ARABIDOPSIS THALIANA SIN3 HOMOLOG, SIN3-like 3 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G038700 [exp] 47 / 9e-08 AT1G70060 1396 / 0.0 SIN3-like 4 (.1) Potri.001G350200 [exp] 46 / 4e-07 AT5G15020 1391 / 0.0 SIN3-like 2 (.1.2) Potri.008G192200 [exp] 45 / 4e-07 AT1G24190 1330 / 0.0 ARABIDOPSIS THALIANA SIN3 HOMOLOG, SIN3-like 3 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02671 [flax] [poplar] PAH Paired amphipathic helix repeat
Representative CDS sequence Show only first row Show all	>Lus10013290 pacid=23166654 polypeptide=Lus10013290 locus=Lus10013290.g ID=Lus10013290.BGIv1.0 annot-version=v1.0 ATGAAGGACTTGTTGAGAGGGTATCCTCACCTGATGTTGGGGTTCTATACCTTCTTTCCAAAGGAGAAAAAGATCACTGATCTCGTACTGGAGGGTGATG AACAGCCTCCTCAACCCAAGAAACTAGTCGACATGGGGAAAGCCAGTAAATTTCCTGACAAAATTAAGGCGGCTCCTCTGCTGAGAGACCACCCAGATTT GCTTCGAGAGTTTGGGGAATACTTGACTTGA
AA sequence Show only first row Show all	>Lus10013290 pacid=23166654 polypeptide=Lus10013290 locus=Lus10013290.g ID=Lus10013290.BGIv1.0 annot-version=v1.0 MKDLLRGYPHLMLGFYTFFPKEKKITDLVLEGDEQPPQPKKLVDMGKASKFPDKIKAAPLLRDHPDLLREFGEYLT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10013290 [exp]	0	1

Compare expression of checked genes

Lus10013290 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.