Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G06210 94 / 2e-25 RNA binding (RRM/RBD/RNP motifs) family protein (.1) AT2G27330 92 / 5e-25 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT2G37510 79 / 9e-20 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT3G46020 75 / 1e-18 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT4G13850 74 / 6e-18 ATGRP2, GR-RBP2 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4) AT1G73530 76 / 8e-18 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT3G23830 74 / 8e-18 AtGRP4, GR-RBP4, GRP4 glycine-rich RNA-binding protein 4 (.1.2) AT4G39260 71 / 8e-17 ATGRP8, CCR1, GR-RBP8 glycine-rich RNA-binding protein 8, GLYCINE-RICH PROTEIN 8, cold, circadian rhythm, and RNA binding 1 (.1.2.3.4) AT4G13860 69 / 2e-16 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT5G47320 71 / 8e-16 RPS19 ribosomal protein S19 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029426 [exp] 86 / 2e-20 AT5G27720 190 / 2e-58 SM-like protein 4, embryo defective 1644, Small nuclear ribonucleoprotein family protein (.1) Lus10023758 [exp] 82 / 2e-20 AT2G37510 164 / 9e-53 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10003980 [exp] 79 / 3e-19 AT2G37510 169 / 1e-54 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10016639 [exp] 75 / 8e-18 AT4G13850 166 / 1e-53 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4) Lus10022551 [exp] 73 / 3e-17 AT4G13850 167 / 7e-54 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4) Lus10015146 [exp] 69 / 6e-16 AT3G08000 145 / 5e-46 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10031534 [exp] 69 / 6e-16 AT3G08000 146 / 2e-46 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10040454 [exp] 71 / 8e-16 AT2G21660 148 / 3e-45 GLYCINE-RICH RNA-BINDING PROTEIN 7, "cold, circadian rhythm, and rna binding 2", GLYCINE RICH PROTEIN 7, cold, circadian rhythm, and rna binding 2 (.1.2) Lus10043158 [exp] 68 / 3e-15 AT4G13850 154 / 1e-48 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G160300 [exp] 101 / 1e-28 AT2G27330 98 / 1e-27 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.006G208500 [exp] 99 / 1e-27 AT5G06210 160 / 1e-51 RNA binding (RRM/RBD/RNP motifs) family protein (.1) Potri.012G038200 [exp] 80 / 1e-19 AT1G73530 141 / 6e-43 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.001G319900 [exp] 76 / 2e-18 AT4G13850 140 / 1e-43 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4) Potri.017G059000 [exp] 73 / 2e-17 AT4G13850 134 / 9e-42 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4) Potri.015G057400 [exp] 73 / 1e-16 AT5G61030 157 / 8e-47 glycine-rich RNA-binding protein 3 (.1) Potri.008G022280 [exp] 71 / 2e-16 AT3G20930 203 / 2e-65 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.012G061600 [exp] 71 / 9e-16 AT5G61030 181 / 9e-56 glycine-rich RNA-binding protein 3 (.1) Potri.010G237200 [exp] 72 / 1e-15 AT3G20930 429 / 5e-150 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.014G157300 [exp] 69 / 1e-15 AT3G08000 129 / 2e-39 RNA-binding (RRM/RBD/RNP motifs) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0221 [flax] [poplar] RRM PF00076 [flax] [poplar] RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Representative CDS sequence Show only first row Show all	>Lus10013306 pacid=23151369 polypeptide=Lus10013306 locus=Lus10013306.g ID=Lus10013306.BGIv1.0 annot-version=v1.0 ATGCAGTCGGCGATAAGAGCAATTTTCCAGGAAAACCCTAACTACGCTGCAACTTGCCAGTTCTTCTCCAGACATTTCTCTTCCAGGCTCTTCGTCAAAG GTCTTCCTTTCTCCACAACAGAGGAAATGTTAGCTAACGCATTCTCTGAGTTTGGTAACGTGGTGCAAGCTCAAGTAATCATGGGAAAGGACAAGAAGAA ATCGAAAGGTTTCGGATACGTCACCTTTGAGTCTGAGGATCAAGCGCAGAAGGCACAAACGAGCATGAACGGGAAGACGATGAATGGCCGTGTCTTGTTT GTCGATGATGTCGACAATTGCTTGGGGAATAAGGTAGAGAAAGCAGCTAAGCGAGAGGAAAAGCTGGTCGGGAAGCCAGGGGTAGCTGACAGTTGA
AA sequence Show only first row Show all	>Lus10013306 pacid=23151369 polypeptide=Lus10013306 locus=Lus10013306.g ID=Lus10013306.BGIv1.0 annot-version=v1.0 MQSAIRAIFQENPNYAATCQFFSRHFSSRLFVKGLPFSTTEEMLANAFSEFGNVVQAQVIMGKDKKKSKGFGYVTFESEDQAQKAQTSMNGKTMNGRVLF VDDVDNCLGNKVEKAAKREEKLVGKPGVADS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G06210			RNA binding (RRM/RBD/RNP motif...		Lus10013306 [exp]	0	1
AT1G65650		UCH2	Peptidase C12, ubiquitin carbo...		Lus10042047 [exp]	1.0	0.8918
AT4G14965		ATMAPR4	membrane-associated progestero...		Lus10018026 [exp]	2.0	0.8909
AT1G08780		PFD4, PDF4, AIP...	PREFOLDIN 4, ABI3-interacting ...		Lus10021994 [exp]	3.5	0.8654
AT5G08630			DDT domain-containing protein ...		Lus10029550 [exp]	4.2	0.8603
AT5G64680			unknown protein		Lus10011265 [exp]	4.9	0.8677
AT5G09250		KIWI	ssDNA-binding transcriptional ...		Lus10039207 [exp]	6.9	0.8191
AT2G37060	CCAAT	NF-YB8	"nuclear factor Y, subunit B8"...		Lus10023484 [exp]	7.5	0.8629
					Lus10028086 [exp]	9.5	0.8412
AT4G36290		CRT1	compromised recognition of TCV...		Lus10014276 [exp]	11.0	0.8504
AT5G47890			NADH-ubiquinone oxidoreductase...		Lus10030922 [exp]	11.5	0.8638

Compare expression of checked genes

Lus10013306 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.