Lus10013314 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G06640 166 / 1e-49 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3)
AT1G06620 164 / 2e-48 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G03410 164 / 5e-48 2A6 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G06650 162 / 6e-48 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT1G03400 160 / 6e-47 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT2G30830 159 / 2e-46 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G04350 157 / 9e-46 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT5G43440 150 / 1e-43 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT2G30840 150 / 7e-43 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT5G59530 149 / 1e-42 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009238 215 / 9e-68 AT1G06640 250 / 2e-80 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3)
Lus10022190 180 / 5e-55 AT1G06620 323 / 6e-110 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10000612 177 / 3e-53 AT5G59540 337 / 2e-114 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Lus10022195 174 / 4e-52 AT1G06620 432 / 1e-151 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10022415 171 / 6e-51 AT1G06620 432 / 6e-152 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10022189 171 / 8e-51 AT1G06620 418 / 3e-146 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10027585 171 / 1e-50 AT1G06620 429 / 3e-150 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10022196 167 / 2e-49 AT5G59530 420 / 5e-147 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10033879 166 / 5e-49 AT5G59540 312 / 8e-105 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G073100 201 / 3e-62 AT1G06650 414 / 2e-144 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.004G083100 180 / 3e-54 AT1G04350 287 / 5e-95 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.017G135800 180 / 4e-54 AT1G06620 323 / 1e-108 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.013G045000 178 / 2e-53 AT1G06620 369 / 6e-127 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.005G222300 178 / 2e-53 AT1G06620 340 / 3e-115 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.017G136000 175 / 2e-52 AT1G06620 314 / 2e-105 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.008G165400 169 / 5e-50 AT1G06620 444 / 1e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.010G073166 167 / 2e-49 AT1G06620 470 / 7e-167 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.010G073300 167 / 2e-49 AT1G06620 455 / 7e-161 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.002G040700 167 / 4e-49 AT1G06620 330 / 2e-111 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0029 Cupin PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
Representative CDS sequence
>Lus10013314 pacid=23151342 polypeptide=Lus10013314 locus=Lus10013314.g ID=Lus10013314.BGIv1.0 annot-version=v1.0
ATGGCATCACCACCGGCCTCCTTCTTCTCGCCCAGCGACCCCGGCAGCCTCGCCGCAGCCAAAGAAGCTGTGACCCAATTCGACAAGACGAAAGCCGGCG
TCAAGGGTCTCGTAGACACCGGCATAACCAAAGTCCCCATACTCTTCCGGCTCTCCCCTAAGACCGCTTCCCTGTACGACACCAAATCATACCAAAACGA
CACCGTTACTGCATCATCCCCTGCCGTGATCGACTTAAAAGGTGTGGCAGCAGGGGGCGCGCGTCGGGCGGAAGTGGTTGATGAGATCCGACGTCGGTCG
GCCGGGATGGGAGTGTTCCAGGTGGTGAACCACGGGGTGGCAGGGAGCGAGATGGAGGAGATGCTGTCGAAAGCGCGTGAGTTTCACGAGCAGCCTAAGG
AGCTGAAGGAGGAGTATTACAGTAGAGATGTTATGAAGAAGGTTAGGATGTTTAGTGGGTACGGGTCGAGGATGAGAGTTGGGAAGTTGTATTGGATGGA
TTCGTTGGCTTGTCAAATGCTTGCTCATGAGGGAGCTCTTGATCCTCAAGAGTTCCCTCCCGTTTGCAGGAACACTATATTGAAATTCTCAGAAGACATT
CGAGAACTCGGTACGACCTTATCAGAACTGTTCTCAGAAGCGCTAGGGCTCGCACCCGATCACCTGAAGAAAATCAACTCGGTCAACTTGCAAAGAATCG
GTTTGAACTATTATCCAGCCTGTCCTGAACCGGAAGTCGCCACAGGTCAAGGCCCGCATTTCGACCCGTTTACTTTCACCGTTCTGCTCCAAGACCGAAC
CGGAGGGCTGCAGGTTTTCCACGACGGCGGGGGGGGTGTGGCGCGCCCTGGTTAA
AA sequence
>Lus10013314 pacid=23151342 polypeptide=Lus10013314 locus=Lus10013314.g ID=Lus10013314.BGIv1.0 annot-version=v1.0
MASPPASFFSPSDPGSLAAAKEAVTQFDKTKAGVKGLVDTGITKVPILFRLSPKTASLYDTKSYQNDTVTASSPAVIDLKGVAAGGARRAEVVDEIRRRS
AGMGVFQVVNHGVAGSEMEEMLSKAREFHEQPKELKEEYYSRDVMKKVRMFSGYGSRMRVGKLYWMDSLACQMLAHEGALDPQEFPPVCRNTILKFSEDI
RELGTTLSELFSEALGLAPDHLKKINSVNLQRIGLNYYPACPEPEVATGQGPHFDPFTFTVLLQDRTGGLQVFHDGGGGVARPG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G06640 2-oxoglutarate (2OG) and Fe(II... Lus10013314 0 1
AT5G12390 FIS1B FISSION 1B, Tetratricopeptide ... Lus10009707 2.8 0.7960
AT4G12320 CYP706A6 "cytochrome P450, family 706, ... Lus10024573 3.9 0.8065
Lus10010248 5.5 0.7585
AT1G33340 ENTH/ANTH/VHS superfamily prot... Lus10032674 6.5 0.8087
Lus10005511 7.3 0.6752
AT5G59190 subtilase family protein (.1) Lus10040251 7.7 0.7690
AT2G19330 PIRL6 plant intracellular ras group-... Lus10003229 8.1 0.8209
AT4G24040 TREHALASE1, ATT... trehalase 1 (.1) Lus10032434 9.4 0.7457
AT5G36930 Disease resistance protein (TI... Lus10002249 12.7 0.7064
AT5G27750 F-box/FBD-like domains contain... Lus10004848 17.0 0.6514

Lus10013314 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.