Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G59540 64 / 1e-13 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT3G61400 63 / 4e-13 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G43440 62 / 1e-12 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT1G06650 61 / 2e-12 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT1G06620 60 / 5e-12 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G04380 59 / 1e-11 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G59530 59 / 2e-11 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G03410 58 / 3e-11 2A6 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G04350 57 / 5e-11 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G06640 57 / 5e-11 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005202 [exp] 160 / 9e-52 AT1G06620 104 / 2e-27 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10009238 [exp] 87 / 2e-21 AT1G06640 250 / 2e-80 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3) Lus10022189 [exp] 67 / 2e-14 AT1G06620 418 / 3e-146 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10002892 [exp] 64 / 2e-13 AT1G06620 381 / 1e-131 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10021202 [exp] 62 / 9e-13 AT1G06620 202 / 2e-60 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10017701 [exp] 61 / 3e-12 AT1G06620 346 / 2e-118 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10041230 [exp] 60 / 3e-12 AT5G59530 270 / 1e-90 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10027585 [exp] 60 / 5e-12 AT1G06620 429 / 3e-150 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10001108 [exp] 60 / 7e-12 AT1G06620 362 / 2e-124 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G073100 [exp] 72 / 2e-16 AT1G06650 414 / 2e-144 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.010G073300 [exp] 72 / 3e-16 AT1G06620 455 / 7e-161 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.008G165400 [exp] 69 / 4e-15 AT1G06620 444 / 1e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.011G156200 [exp] 64 / 1e-13 AT1G06650 430 / 7e-151 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.010G073166 [exp] 64 / 2e-13 AT1G06620 470 / 7e-167 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.013G045000 [exp] 64 / 3e-13 AT1G06620 369 / 6e-127 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.010G073232 [exp] 62 / 1e-12 AT1G06620 402 / 7e-140 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.002G040700 [exp] 59 / 1e-11 AT1G06620 330 / 2e-111 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.017G135800 [exp] 57 / 8e-11 AT1G06620 323 / 1e-108 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.005G222300 [exp] 56 / 1e-10 AT1G06620 340 / 3e-115 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [flax] [poplar] Cupin PF03171 [flax] [poplar] 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
Representative CDS sequence Show only first row Show all	>Lus10013315 pacid=23151331 polypeptide=Lus10013315 locus=Lus10013315.g ID=Lus10013315.BGIv1.0 annot-version=v1.0 ATGCAGCTGATAAGCAATGGCAGACTGAAGAGTGGAGAACACAAGGTGGTAGCGAATCGAACCGGGTCGAGAGTTTCGGCCGGGTTCTTTTTCGAGCCGG TGATTGATTTTTCGAATGGTTCGAAGAGAATGTACGGTCCGATCGAGGAGTTGATATCTGAAGAGCATCCTAAGGTGTATCGTGAAATTAGTTTGGATGA GTTGCTGGACACTGTACTTCCAGACGGTGAAGCATCTCATGAGAGGAATTCTGGAATGGCTGGTTTCAAATTACATTATTAG
AA sequence Show only first row Show all	>Lus10013315 pacid=23151331 polypeptide=Lus10013315 locus=Lus10013315.g ID=Lus10013315.BGIv1.0 annot-version=v1.0 MQLISNGRLKSGEHKVVANRTGSRVSAGFFFEPVIDFSNGSKRMYGPIEELISEEHPKVYREISLDELLDTVLPDGEASHERNSGMAGFKLHY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G59540			2-oxoglutarate (2OG) and Fe(II...		Lus10013315 [exp]	0	1
AT5G48450		SKS3	SKU5 similar 3 (.1)		Lus10040424 [exp]	2.0	0.7729
AT3G12690		AGC1.5	AGC kinase 1.5 (.1.2.3)		Lus10001757 [exp]	3.0	0.7881
AT5G04390	C2H2ZnF		C2H2-type zinc finger family p...		Lus10040425 [exp]	3.9	0.7668
AT4G24040		TREHALASE1, ATT...	trehalase 1 (.1)		Lus10032434 [exp]	4.9	0.7560
					Lus10021979 [exp]	10.0	0.7240
					Lus10032314 [exp]	13.9	0.7328
AT5G51030			NAD(P)-binding Rossmann-fold s...		Lus10032524 [exp]	15.2	0.7310
					Lus10032828 [exp]	16.2	0.7310
AT3G04120		GAPC1, GAPC-1, ...	glyceraldehyde-3-phosphate deh...		Lus10033306 [exp]	17.2	0.7310
AT3G10740		ATASD1, ARAF1, ...	ARABIDOPSIS THALIANA ALPHA-L-A...		Lus10031008 [exp]	17.7	0.6923

Compare expression of checked genes

Lus10013315 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.