Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G58370 89 / 1e-22 ATXYN1, RXF12 ARABIDOPSIS THALIANA XYLANASE 1, glycosyl hydrolase family 10 protein / carbohydrate-binding domain-containing protein (.1) AT1G10050 76 / 4e-18 glycosyl hydrolase family 10 protein / carbohydrate-binding domain-containing protein (.1) AT4G08160 74 / 3e-17 Atxyn3 glycosyl hydrolase family 10 protein / carbohydrate-binding domain-containing protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007243 [exp] 115 / 1e-31 AT1G58370 1291 / 0.0 ARABIDOPSIS THALIANA XYLANASE 1, glycosyl hydrolase family 10 protein / carbohydrate-binding domain-containing protein (.1) Lus10028243 [exp] 115 / 1e-31 AT1G58370 1278 / 0.0 ARABIDOPSIS THALIANA XYLANASE 1, glycosyl hydrolase family 10 protein / carbohydrate-binding domain-containing protein (.1) Lus10011465 [exp] 99 / 5e-26 AT1G10050 807 / 0.0 glycosyl hydrolase family 10 protein / carbohydrate-binding domain-containing protein (.1) Lus10037528 [exp] 97 / 2e-25 AT1G58370 1064 / 0.0 ARABIDOPSIS THALIANA XYLANASE 1, glycosyl hydrolase family 10 protein / carbohydrate-binding domain-containing protein (.1) Lus10028242 [exp] 79 / 5e-19 AT1G58370 998 / 0.0 ARABIDOPSIS THALIANA XYLANASE 1, glycosyl hydrolase family 10 protein / carbohydrate-binding domain-containing protein (.1) Lus10007242 [exp] 78 / 1e-18 AT1G58370 1016 / 0.0 ARABIDOPSIS THALIANA XYLANASE 1, glycosyl hydrolase family 10 protein / carbohydrate-binding domain-containing protein (.1) Lus10020790 [exp] 0 / 1 AT1G58370 71 / 7e-16 ARABIDOPSIS THALIANA XYLANASE 1, glycosyl hydrolase family 10 protein / carbohydrate-binding domain-containing protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G113132 [exp] 91 / 3e-23 AT1G58370 1352 / 0.0 ARABIDOPSIS THALIANA XYLANASE 1, glycosyl hydrolase family 10 protein / carbohydrate-binding domain-containing protein (.1) Potri.002G113066 [exp] 89 / 2e-22 AT1G58370 1064 / 0.0 ARABIDOPSIS THALIANA XYLANASE 1, glycosyl hydrolase family 10 protein / carbohydrate-binding domain-containing protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10013322 pacid=23151354 polypeptide=Lus10013322 locus=Lus10013322.g ID=Lus10013322.BGIv1.0 annot-version=v1.0 ATGATCACTGACAAAGTCAAGCTCTTCTCGACATACCAGATAGCTGCTTGGGTTGAGATTAGCCCTACTGGAGCCAATAGTGGAACTCAAAATGTGAGTC TTGGTGTAGACAATAACTGGGTCAATGGAGGACAAGTCGAGATCAACGATGATCGATGGCATGAAATCGGTAGCTCCTTCAGAATCCCTGATTTCAATCC TTAA
AA sequence Show only first row Show all	>Lus10013322 pacid=23151354 polypeptide=Lus10013322 locus=Lus10013322.g ID=Lus10013322.BGIv1.0 annot-version=v1.0 MITDKVKLFSTYQIAAWVEISPTGANSGTQNVSLGVDNNWVNGGQVEINDDRWHEIGSSFRIPDFNP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G58370		ATXYN1, RXF12	ARABIDOPSIS THALIANA XYLANASE ...		Lus10013322 [exp]	0	1
AT4G20140		GSO1	GASSHO1, Leucine-rich repeat t...		Lus10033519 [exp]	10.2	0.7805
					Lus10004843 [exp]	22.0	0.7919
AT1G11920			Pectin lyase-like superfamily ...		Lus10011257 [exp]	52.5	0.7480
AT1G57790			F-box family protein (.1)		Lus10014208 [exp]	53.4	0.7643
AT1G62300	WRKY	ATWRKY6, WRKY6	WRKY family transcription fact...		Lus10021554 [exp]	72.2	0.7280
AT4G14590		EMB2739	embryo defective 2739 (.1)		Lus10032903 [exp]	96.1	0.7158
AT2G27710			60S acidic ribosomal protein f...		Lus10014070 [exp]	96.7	0.7239
AT5G57280		RID2	root initiation defective 2, S...		Lus10015533 [exp]	99.9	0.7419
AT1G04980		ATPDI10, ATPDIL...	ARABIDOPSIS THALIANA PROTEIN D...		Lus10034528 [exp]	101.2	0.7483
AT3G25140		QUA1, GAUT8	QUASIMODO 1, GALACTURONOSYLTRA...		Lus10029734 [exp]	118.5	0.7337

Compare expression of checked genes

Lus10013322 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.