Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G27260 89 / 1e-22 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005216 [exp] 244 / 2e-83 AT2G27260 152 / 2e-45 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10034173 [exp] 120 / 1e-34 AT2G27260 149 / 2e-44 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10043411 [exp] 116 / 4e-33 AT2G27260 148 / 6e-44 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10041350 [exp] 57 / 2e-11 AT5G22870 94 / 3e-25 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10021404 [exp] 54 / 8e-10 AT5G22870 151 / 6e-46 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10016161 [exp] 51 / 1e-08 AT5G22870 148 / 8e-45 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G218300 [exp] 106 / 2e-29 AT2G27260 94 / 6e-23 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.009G019800 [exp] 96 / 3e-25 AT2G27260 96 / 1e-23 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.006G204000 [exp] 59 / 2e-11 AT3G52460 146 / 4e-42 hydroxyproline-rich glycoprotein family protein (.1) Potri.009G003800 [exp] 53 / 2e-09 AT5G22870 179 / 4e-57 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10013329 pacid=23151406 polypeptide=Lus10013329 locus=Lus10013329.g ID=Lus10013329.BGIv1.0 annot-version=v1.0 ATGAGCGTCGAGTACGATCCGGTCACGTCGTCCGTGTTCTACCAGAGGGAGTTTCTCACGGAGACGCGGATCGGGCCGTTCAATCAGCAGGGCAGGAATC TGACGGCTGTGGAGGCTCGTTACACCGTTGTCAATACTTTCGTTGATCGGTGGGTGACGGACGAGGTTGACAAGGAGAAGAGGAAGCTTGGCTCCGTGGC TTTCGATTTGAGAGTTGTGGCTGGTGCAGGGTTTAAGTATGGTGGGTTTAGAGCCAGGAGACGAATTCTTCGTGTTCACTGCGACGATTTGACTGTGGCG ATTCGTGGTAATGGTGGGAACATGTCCAATGTTCCCAAACGATGCTACGTTTATGCTTGA
AA sequence Show only first row Show all	>Lus10013329 pacid=23151406 polypeptide=Lus10013329 locus=Lus10013329.g ID=Lus10013329.BGIv1.0 annot-version=v1.0 MSVEYDPVTSSVFYQREFLTETRIGPFNQQGRNLTAVEARYTVVNTFVDRWVTDEVDKEKRKLGSVAFDLRVVAGAGFKYGGFRARRRILRVHCDDLTVA IRGNGGNMSNVPKRCYVYA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G27260			Late embryogenesis abundant (L...		Lus10013329 [exp]	0	1
AT3G03980			NAD(P)-binding Rossmann-fold s...		Lus10020265 [exp]	1.0	0.9453
AT2G43090			Aconitase/3-isopropylmalate de...		Lus10007804 [exp]	2.0	0.9064
AT2G27260			Late embryogenesis abundant (L...		Lus10005216 [exp]	2.4	0.9183
AT1G07710			Ankyrin repeat family protein ...		Lus10024440 [exp]	2.4	0.9103
AT3G56880			VQ motif-containing protein (....		Lus10012292 [exp]	3.0	0.8928
AT1G07530	GRAS	SCL14, ATGRAS2	GRAS \(GAI, RGA, SCR\) 2, ARAB...		Lus10016519 [exp]	3.3	0.8800
AT3G07360		ATPUB9	ARABIDOPSIS THALIANA PLANT U-B...		Lus10025885 [exp]	3.5	0.9016
AT4G33565			RING/U-box superfamily protein...		Lus10012745 [exp]	5.0	0.9056
AT4G30440		GAE1	UDP-D-glucuronate 4-epimerase ...		Lus10015496 [exp]	7.5	0.8972
AT3G07790			DGCR14-related (.1)		Lus10012321 [exp]	7.7	0.8620

Compare expression of checked genes

Lus10013329 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.