Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G27250 40 / 2e-05 AtCLV3, CLV3 CLAVATA3 (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001854 [exp] 95 / 1e-26 ND 40 / 3e-05
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G020300 [exp] 45 / 1e-07 AT2G27250 41 / 1e-05 CLAVATA3 (.1.2.3) Potri.001G217500 [exp] 42 / 2e-06 AT2G27250 40 / 2e-05 CLAVATA3 (.1.2.3)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10013340 pacid=23151324 polypeptide=Lus10013340 locus=Lus10013340.g ID=Lus10013340.BGIv1.0 annot-version=v1.0 ATGTTCCTCCGTTTCTTACTCATCGCAGCCATGCTGCTCTTCTCCTCCTCCTCCTCCTCTTCCTCCTCGTACGTCTGTCTTGCTCATGGATCAGTTTCCA GATTTCCCCACGCTGCTGCTGCTGCTGCCGGCCGAACCAGAAAGGTGTTGGCTGGGGTGGCGAAGGAGGAGGGTGGTAAAAATAAGGAAGAGTTGAGAAC AGTTCCTTCAGGGCCAGACCCTTTGCATCATAATGGTGGAACTCCCAACAAGAAGCCCCGACCTACTTCCCCTTGA
AA sequence Show only first row Show all	>Lus10013340 pacid=23151324 polypeptide=Lus10013340 locus=Lus10013340.g ID=Lus10013340.BGIv1.0 annot-version=v1.0 MFLRFLLIAAMLLFSSSSSSSSSYVCLAHGSVSRFPHAAAAAAGRTRKVLAGVAKEEGGKNKEELRTVPSGPDPLHHNGGTPNKKPRPTSP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G27250		AtCLV3, CLV3	CLAVATA3 (.1.2.3)		Lus10013340 [exp]	0	1
					Lus10015895 [exp]	7.8	0.9967
AT1G18720			Protein of unknown function (D...		Lus10001647 [exp]	8.1	0.9969
					Lus10027902 [exp]	8.1	0.9948
					Lus10007403 [exp]	11.4	0.9969
					Lus10035743 [exp]	14.0	0.9969
AT5G38760			Late embryogenesis abundant pr...		Lus10026292 [exp]	14.6	0.9494
AT3G25040		ERD2B	endoplasmic reticulum retentio...		Lus10043149 [exp]	16.1	0.9969
AT1G47790			F-box and associated interacti...		Lus10042015 [exp]	18.0	0.9969
					Lus10010414 [exp]	19.7	0.9969
AT3G26410		TRM11, AtTRM11	tRNA modification 11, methyltr...		Lus10018147 [exp]	20.4	0.9506

Compare expression of checked genes

Lus10013340 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.