Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G24860 65 / 5e-14 Trihelix Homeodomain-like superfamily protein (.1) AT2G44730 62 / 9e-13 Trihelix Alcohol dehydrogenase transcription factor Myb/SANT-like family protein (.1) AT3G10030 44 / 2e-06 Trihelix aspartate/glutamate/uridylate kinase family protein (.1.2) AT3G58630 43 / 5e-06 Trihelix sequence-specific DNA binding transcription factors (.1) AT3G54390 41 / 2e-05 Trihelix sequence-specific DNA binding transcription factors (.1) AT3G14180 41 / 2e-05 Trihelix ASIL2 Arabidopsis 6B-interacting protein 1-like 2, sequence-specific DNA binding transcription factors (.1) AT3G11100 40 / 4e-05 Trihelix sequence-specific DNA binding transcription factors (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022789 [exp] 66 / 3e-14 AT3G24860 141 / 7e-40 Homeodomain-like superfamily protein (.1) Lus10011851 [exp] 65 / 6e-14 AT3G24860 140 / 1e-39 Homeodomain-like superfamily protein (.1) Lus10000963 [exp] 59 / 1e-11 AT2G44730 124 / 7e-32 Alcohol dehydrogenase transcription factor Myb/SANT-like family protein (.1) Lus10040141 [exp] 56 / 2e-10 AT2G44730 123 / 1e-31 Alcohol dehydrogenase transcription factor Myb/SANT-like family protein (.1) Lus10011020 [exp] 49 / 3e-08 AT2G44730 123 / 7e-32 Alcohol dehydrogenase transcription factor Myb/SANT-like family protein (.1) Lus10020652 [exp] 41 / 3e-05 AT5G16860 344 / 2e-106 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10013179 [exp] 39 / 9e-05 AT3G14180 256 / 5e-81 Arabidopsis 6B-interacting protein 1-like 2, sequence-specific DNA binding transcription factors (.1) Lus10008141 [exp] 39 / 0.0001 AT3G14180 271 / 3e-87 Arabidopsis 6B-interacting protein 1-like 2, sequence-specific DNA binding transcription factors (.1) Lus10024143 [exp] 39 / 0.0002 AT3G54390 172 / 2e-50 sequence-specific DNA binding transcription factors (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G243300 [exp] 92 / 4e-24 AT3G24860 167 / 8e-50 Homeodomain-like superfamily protein (.1) Potri.014G051200 [exp] 63 / 4e-13 AT2G44730 239 / 3e-76 Alcohol dehydrogenase transcription factor Myb/SANT-like family protein (.1) Potri.002G139500 [exp] 62 / 5e-13 AT2G44730 252 / 3e-81 Alcohol dehydrogenase transcription factor Myb/SANT-like family protein (.1) Potri.003G083800 [exp] 56 / 7e-11 AT2G44730 123 / 6e-31 Alcohol dehydrogenase transcription factor Myb/SANT-like family protein (.1) Potri.001G150600 [exp] 54 / 8e-10 AT2G44730 114 / 6e-28 Alcohol dehydrogenase transcription factor Myb/SANT-like family protein (.1) Potri.008G027000 [exp] 44 / 1e-06 AT3G10030 457 / 2e-157 aspartate/glutamate/uridylate kinase family protein (.1.2) Potri.010G233500 [exp] 44 / 2e-06 AT3G10030 434 / 3e-148 aspartate/glutamate/uridylate kinase family protein (.1.2) Potri.T126206 [exp] 41 / 2e-05 AT3G14180 173 / 9e-50 Arabidopsis 6B-interacting protein 1-like 2, sequence-specific DNA binding transcription factors (.1) Potri.003G200000 [exp] 40 / 3e-05 AT3G14180 172 / 2e-49 Arabidopsis 6B-interacting protein 1-like 2, sequence-specific DNA binding transcription factors (.1) Potri.003G118600 [exp] 39 / 0.0001 AT3G58630 139 / 5e-39 sequence-specific DNA binding transcription factors (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10013350 pacid=23151389 polypeptide=Lus10013350 locus=Lus10013350.g ID=Lus10013350.BGIv1.0 annot-version=v1.0 ATGTCGACCCCATCGCCTTCCTCCTCTTCCCCACCACCCAATCAGCCACAATCCTCCTCCACCCCGTACTCGCCGGCACCACCGATCTCCGGCAAGAAAC CCCAGCCAGTCCCCTGGACCCACCAGCAGACAGTCCACCTGATCCAGGCCTACCAGGAGAAATGGTACGGCCTCAACCGCGGCCAGCTCAAGGCCACCCA CTGGGAAGAGGTCGCCGCCGCCGTCGTCTCCCGCTGCGGCCACAACGGATAA
AA sequence Show only first row Show all	>Lus10013350 pacid=23151389 polypeptide=Lus10013350 locus=Lus10013350.g ID=Lus10013350.BGIv1.0 annot-version=v1.0 MSTPSPSSSSPPPNQPQSSSTPYSPAPPISGKKPQPVPWTHQQTVHLIQAYQEKWYGLNRGQLKATHWEEVAAAVVSRCGHNG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G24860	Trihelix		Homeodomain-like superfamily p...		Lus10013350 [exp]	0	1
					Lus10038720 [exp]	13.3	0.5474

Compare expression of checked genes

Lus10013350 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.