Lus10013355 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G31710 220 / 4e-67 Copper amine oxidase family protein (.1)
AT1G31670 216 / 3e-65 Copper amine oxidase family protein (.1)
AT1G31690 206 / 1e-61 Copper amine oxidase family protein (.1)
AT1G62810 172 / 4e-49 Copper amine oxidase family protein (.1)
AT3G43670 171 / 8e-49 Copper amine oxidase family protein (.1)
AT4G12270 164 / 1e-47 Copper amine oxidase family protein (.1)
AT4G14940 161 / 2e-45 ATAO1 amine oxidase 1 (.1)
AT4G12290 154 / 2e-42 Copper amine oxidase family protein (.1)
AT2G42490 74 / 2e-14 Copper amine oxidase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026757 378 / 1e-127 AT1G31690 727 / 0.0 Copper amine oxidase family protein (.1)
Lus10010540 263 / 2e-83 AT1G31710 761 / 0.0 Copper amine oxidase family protein (.1)
Lus10010542 221 / 2e-67 AT1G31710 753 / 0.0 Copper amine oxidase family protein (.1)
Lus10004912 215 / 5e-65 AT1G31710 738 / 0.0 Copper amine oxidase family protein (.1)
Lus10021922 176 / 2e-50 AT4G14940 839 / 0.0 amine oxidase 1 (.1)
Lus10024571 144 / 6e-39 AT4G12290 993 / 0.0 Copper amine oxidase family protein (.1)
Lus10024568 143 / 2e-38 AT1G62810 914 / 0.0 Copper amine oxidase family protein (.1)
Lus10032209 135 / 1e-35 AT4G12290 996 / 0.0 Copper amine oxidase family protein (.1)
Lus10025542 123 / 1e-34 AT1G31710 164 / 1e-47 Copper amine oxidase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G089050 276 / 3e-88 AT1G31710 780 / 0.0 Copper amine oxidase family protein (.1)
Potri.008G151900 251 / 8e-79 AT1G31690 793 / 0.0 Copper amine oxidase family protein (.1)
Potri.010G088800 240 / 1e-74 AT1G31710 782 / 0.0 Copper amine oxidase family protein (.1)
Potri.010G088900 190 / 6e-56 AT4G14940 904 / 0.0 amine oxidase 1 (.1)
Potri.001G118200 162 / 1e-45 AT1G62810 961 / 0.0 Copper amine oxidase family protein (.1)
Potri.001G118300 153 / 4e-42 AT4G12290 1060 / 0.0 Copper amine oxidase family protein (.1)
Potri.012G084400 88 / 2e-19 AT2G42490 1250 / 0.0 Copper amine oxidase family protein (.1)
Potri.010G045600 81 / 3e-17 AT2G42490 1202 / 0.0 Copper amine oxidase family protein (.1)
Potri.015G082900 81 / 3e-17 AT2G42490 1256 / 0.0 Copper amine oxidase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0047 CuAO_N2_N3 PF02728 Cu_amine_oxidN3 Copper amine oxidase, N3 domain
CL0047 CuAO_N2_N3 PF02727 Cu_amine_oxidN2 Copper amine oxidase, N2 domain
Representative CDS sequence
>Lus10013355 pacid=23151404 polypeptide=Lus10013355 locus=Lus10013355.g ID=Lus10013355.BGIv1.0 annot-version=v1.0
ATGGGTTCGGCAAAATCAAACTTCACACTTACCCTTCTCTTCCTCCTCTGCCTCTCCGCCGCCGCCACCATCTCACCAACCACCGCCGCCGGCCACCCAC
TCGACCCGCTCAGCCCCGATGAGCTAACCACTATCCAAACCATCTTCACCGCCACCTTCCCAACCCGGACAATTCAAAACGCCACATTCCACTACATAGG
CCTCGACGAACCCGACAAAAATGCTGTCGTTTCATGGCTCAAAAACCCCTTCTCGTCTCGCTCCCCACCTCGCCGAGCCATGGTCATCACCCGGTCCAAC
CGCCAAACCCACGAAATCGTAATCAACCTTTCGACCCAAACCGTGGAGTCAGACCGGGTCTACCACGGGTCCGGGTACCCAACCTTCACCTTCGAGGAGC
AAATAACAGTCAACCGAATGCCGATGGATTTCGATCCGTTCAAGGAGTCGGTCAGACGGAGAGGCGTTAACTTGACAGACGTCATCTGCTCGTGCTTCCC
CGCTGGGTGGTTTGGTGGCGAAGAGGTGGTTAGCAGAAGGGTCACCAAAGTTCAGTGCTTTGTGACGACGAAAGATTCTGTTAACTTGTACATGATGCCG
TTAGAAGGGATAACGTTATTGGTCGATTTGGACGAGATGAGGATTGTCGAGTATAGTGATAAGGATGGAGCTCCCATGCCCAAAGCTGAAGGGACGGATT
ATAGGATGACGGGACTCGATCCGCCGTTCGGCCCGAGGCTGAACGCTGCCGTTTTGGTTCAGCCCGATGGTCCCGGTTTCACCGTCGATGGGCATTCTGT
CAGAGCAAAACAAGTAAGAATGTAA
AA sequence
>Lus10013355 pacid=23151404 polypeptide=Lus10013355 locus=Lus10013355.g ID=Lus10013355.BGIv1.0 annot-version=v1.0
MGSAKSNFTLTLLFLLCLSAAATISPTTAAGHPLDPLSPDELTTIQTIFTATFPTRTIQNATFHYIGLDEPDKNAVVSWLKNPFSSRSPPRRAMVITRSN
RQTHEIVINLSTQTVESDRVYHGSGYPTFTFEEQITVNRMPMDFDPFKESVRRRGVNLTDVICSCFPAGWFGGEEVVSRRVTKVQCFVTTKDSVNLYMMP
LEGITLLVDLDEMRIVEYSDKDGAPMPKAEGTDYRMTGLDPPFGPRLNAAVLVQPDGPGFTVDGHSVRAKQVRM

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G31710 Copper amine oxidase family pr... Lus10013355 0 1
AT1G31690 Copper amine oxidase family pr... Lus10013356 1.0 0.9740
AT3G12120 FAD2 fatty acid desaturase 2 (.1.2) Lus10021047 2.2 0.9670
AT2G24400 SAUR-like auxin-responsive pro... Lus10035716 2.8 0.9672
AT5G55410 Bifunctional inhibitor/lipid-t... Lus10032575 3.7 0.9688
AT4G12080 AT-hook ATAHL1, AHL1 AT-hook motif nuclear-localize... Lus10002841 4.2 0.9466
AT3G52970 CYP76G1 "cytochrome P450, family 76, s... Lus10021135 5.5 0.9478
AT5G40810 Cytochrome C1 family (.1.2) Lus10041577 7.6 0.9403
AT5G57090 MM31, ATPIN2, A... WAVY ROOTS 6, ETHYLENE INSENSI... Lus10001637 8.1 0.9678
AT4G10350 NAC BRN2, NST4, ANA... BEARSKIN 2, NAC domain contain... Lus10039153 8.5 0.9579
AT5G49950 alpha/beta-Hydrolases superfam... Lus10037322 10.0 0.9524

Lus10013355 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.