Lus10013367 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G27570 144 / 1e-41 UDP-Glycosyltransferase superfamily protein (.1)
AT5G54060 142 / 7e-41 UF3GT UDP-glucose:flavonoid 3-o-glucosyltransferase (.1)
AT1G64920 139 / 5e-40 UDP-Glycosyltransferase superfamily protein (.1)
AT1G50580 137 / 3e-39 UDP-Glycosyltransferase superfamily protein (.1)
AT4G27560 137 / 7e-39 UDP-Glycosyltransferase superfamily protein (.1)
AT4G09500 135 / 1e-38 UDP-Glycosyltransferase superfamily protein (.1.2)
AT5G53990 134 / 9e-38 UDP-Glycosyltransferase superfamily protein (.1)
AT5G54010 130 / 2e-36 UDP-Glycosyltransferase superfamily protein (.1)
AT2G22930 129 / 3e-36 UDP-Glycosyltransferase superfamily protein (.1)
AT1G64910 121 / 5e-33 UDP-Glycosyltransferase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008453 258 / 2e-85 AT5G54010 539 / 0.0 UDP-Glycosyltransferase superfamily protein (.1)
Lus10013337 144 / 2e-41 AT5G54010 452 / 1e-156 UDP-Glycosyltransferase superfamily protein (.1)
Lus10004381 120 / 1e-32 AT5G54060 437 / 1e-150 UDP-glucose:flavonoid 3-o-glucosyltransferase (.1)
Lus10040178 112 / 9e-30 AT5G54010 437 / 7e-151 UDP-Glycosyltransferase superfamily protein (.1)
Lus10039237 90 / 7e-22 AT5G54010 240 / 5e-76 UDP-Glycosyltransferase superfamily protein (.1)
Lus10012726 90 / 1e-21 AT2G22590 471 / 3e-164 UDP-Glycosyltransferase superfamily protein (.1)
Lus10003154 83 / 5e-19 AT5G54010 318 / 3e-104 UDP-Glycosyltransferase superfamily protein (.1)
Lus10026412 77 / 2e-18 AT2G22590 173 / 1e-52 UDP-Glycosyltransferase superfamily protein (.1)
Lus10042241 76 / 4e-18 AT5G65550 168 / 4e-51 UDP-Glycosyltransferase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G097900 170 / 1e-51 AT5G54010 498 / 1e-174 UDP-Glycosyltransferase superfamily protein (.1)
Potri.011G061000 128 / 1e-35 AT5G54010 468 / 6e-163 UDP-Glycosyltransferase superfamily protein (.1)
Potri.017G041900 105 / 1e-27 AT5G54010 348 / 1e-116 UDP-Glycosyltransferase superfamily protein (.1)
Potri.012G034100 82 / 5e-19 AT2G22590 505 / 2e-177 UDP-Glycosyltransferase superfamily protein (.1)
Potri.010G182575 82 / 6e-19 AT5G49690 468 / 7e-163 UDP-Glycosyltransferase superfamily protein (.1)
Potri.006G179700 75 / 3e-16 AT5G54010 349 / 2e-116 UDP-Glycosyltransferase superfamily protein (.1)
Potri.017G042800 74 / 7e-16 AT5G49690 377 / 3e-127 UDP-Glycosyltransferase superfamily protein (.1)
Potri.002G162300 72 / 2e-15 AT2G22590 372 / 6e-125 UDP-Glycosyltransferase superfamily protein (.1)
Potri.003G184400 69 / 3e-14 AT5G49690 549 / 0.0 UDP-Glycosyltransferase superfamily protein (.1)
Potri.001G030600 68 / 6e-14 AT2G22590 537 / 0.0 UDP-Glycosyltransferase superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10013367 pacid=23151352 polypeptide=Lus10013367 locus=Lus10013367.g ID=Lus10013367.BGIv1.0 annot-version=v1.0
ATGGCTTCCGAAACCAAAAAATTCCACATAGTGATGTTCCCATGGCTAGCAACTGGTCACATCACCCCATTCCTTCACCTCTCCAACACCCTAGCTAGCA
AAGGCTTCACCATCACATTCATCCTCCCCCAAAAGTCAATCCAACAATTCTCCGTGTTCAACCAACACCCGGATCTCATTGATTTCTACCCCATCGTGCT
CTCTCCCGTCGATAGCCTCCCCGCCGGAGTGGAGACCGCCTCTGAGGTCCCTATTGAGGTCACCCACTTTTTGTGCATTGCCATGGATCGAACTCGAGAT
CAGGTGGAAAAAATTATCCGTGGAACCAACCCTAAGGTAGTGGAGTATGACATGACACATTGGGTGTTTGACATCACTGCCTCGTTGGGGATAAAGAGCG
TGAACTACACGTCCTCTCTGCATCTGTCGTTGCCTTTGCGGATGTTCCCACGCGTGGAATTGTGA
AA sequence
>Lus10013367 pacid=23151352 polypeptide=Lus10013367 locus=Lus10013367.g ID=Lus10013367.BGIv1.0 annot-version=v1.0
MASETKKFHIVMFPWLATGHITPFLHLSNTLASKGFTITFILPQKSIQQFSVFNQHPDLIDFYPIVLSPVDSLPAGVETASEVPIEVTHFLCIAMDRTRD
QVEKIIRGTNPKVVEYDMTHWVFDITASLGIKSVNYTSSLHLSLPLRMFPRVEL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G27570 UDP-Glycosyltransferase superf... Lus10013367 0 1
AT3G12750 ZIP1 zinc transporter 1 precursor (... Lus10014062 2.8 0.9945
Lus10029261 4.0 0.9945
AT4G27420 ABCG9 ATP-binding cassette G9, ABC-2... Lus10025597 4.5 0.9453
AT5G01660 unknown protein Lus10040599 4.9 0.9945
AT1G44100 AAP5 amino acid permease 5 (.1) Lus10042742 5.2 0.9054
Lus10038051 5.7 0.9945
Lus10003825 6.3 0.9945
AT5G56990 unknown protein Lus10029528 6.9 0.9945
AT2G47430 CKI1 CYTOKININ-INDEPENDENT 1, Signa... Lus10035114 7.4 0.7743
AT4G27420 ABCG9 ATP-binding cassette G9, ABC-2... Lus10029635 7.5 0.9945

Lus10013367 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.