Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G27570 105 / 1e-27 UDP-Glycosyltransferase superfamily protein (.1) AT4G27560 100 / 9e-26 UDP-Glycosyltransferase superfamily protein (.1) AT5G53990 98 / 5e-25 UDP-Glycosyltransferase superfamily protein (.1) AT1G64910 97 / 9e-25 UDP-Glycosyltransferase superfamily protein (.1) AT5G54010 94 / 2e-23 UDP-Glycosyltransferase superfamily protein (.1) AT2G22930 90 / 4e-22 UDP-Glycosyltransferase superfamily protein (.1) AT1G64920 90 / 5e-22 UDP-Glycosyltransferase superfamily protein (.1) AT4G09500 87 / 5e-21 UDP-Glycosyltransferase superfamily protein (.1.2) AT5G54060 81 / 1e-18 UF3GT UDP-glucose:flavonoid 3-o-glucosyltransferase (.1) AT1G50580 75 / 1e-16 UDP-Glycosyltransferase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027483 [exp] 107 / 1e-30 AT4G27570 89 / 3e-35 UDP-Glycosyltransferase superfamily protein (.1) Lus10004381 [exp] 77 / 2e-17 AT5G54060 437 / 1e-150 UDP-glucose:flavonoid 3-o-glucosyltransferase (.1) Lus10039236 [exp] 61 / 2e-13 AT4G27570 61 / 7e-13 UDP-Glycosyltransferase superfamily protein (.1) Lus10003154 [exp] 52 / 1e-08 AT5G54010 318 / 3e-104 UDP-Glycosyltransferase superfamily protein (.1) Lus10000643 [exp] 50 / 7e-08 AT1G69170 192 / 4e-55 Squamosa promoter-binding protein-like (SBP domain) transcription factor family protein (.1) Lus10002350 [exp] 47 / 7e-07 AT1G64910 179 / 2e-54 UDP-Glycosyltransferase superfamily protein (.1) Lus10001858 [exp] 38 / 0.0005 AT4G27570 99 / 2e-25 UDP-Glycosyltransferase superfamily protein (.1) Lus10036087 [exp] 39 / 0.0007 AT3G21790 455 / 3e-157 UDP-Glycosyltransferase superfamily protein (.1) Lus10040178 [exp] 0 / 1 AT5G54010 437 / 7e-151 UDP-Glycosyltransferase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G097900 [exp] 122 / 8e-34 AT5G54010 498 / 1e-174 UDP-Glycosyltransferase superfamily protein (.1) Potri.011G061000 [exp] 75 / 1e-16 AT5G54010 468 / 6e-163 UDP-Glycosyltransferase superfamily protein (.1) Potri.006G179700 [exp] 65 / 3e-13 AT5G54010 349 / 2e-116 UDP-Glycosyltransferase superfamily protein (.1) Potri.017G041900 [exp] 64 / 8e-13 AT5G54010 348 / 1e-116 UDP-Glycosyltransferase superfamily protein (.1) Potri.015G071900 [exp] 42 / 5e-05 AT1G24100 427 / 5e-147 UDP-glucosyl transferase 74B1 (.1) Potri.017G032500 [exp] 42 / 5e-05 AT1G05680 446 / 1e-154 Uridine diphosphate glycosyltransferase 74E2 (.1) Potri.010G084900 [exp] 38 / 0.001 AT3G02100 307 / 9e-100 UDP-Glycosyltransferase superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10013368 pacid=23151356 polypeptide=Lus10013368 locus=Lus10013368.g ID=Lus10013368.BGIv1.0 annot-version=v1.0 ATGGGTTCAACAAGTCTCGATACTGAACCACCTGTCCGTCGAGTGCTTCATGAACCACTACGGGTTTGGGTCGATGTGAGACTCGTTAATGAGCAATTCC CAAATTGTGTTGGTCCGTATTTAGGGGACCAAGTTTTGAACACTAGACTGATGGCTGATGAGCTAAAGGTTGGTTTGGAAGTGGAAAGAGATGAGAAAGG TTGGGTTTCAAAGGAGAAGCTAAGTGAAGCAATCACATGTGTTATGGATAAAGGAAATGAGTTGGGTTGTTCTCTAAGGAATAATCATTCCGAGTGGAGA GGTGTGGTTTCTGATCCAGATTTCATGTCTAGCTACATTGACAAGTTTGTTCAAAATTTGCATGATCTTGTGAAGTGA
AA sequence Show only first row Show all	>Lus10013368 pacid=23151356 polypeptide=Lus10013368 locus=Lus10013368.g ID=Lus10013368.BGIv1.0 annot-version=v1.0 MGSTSLDTEPPVRRVLHEPLRVWVDVRLVNEQFPNCVGPYLGDQVLNTRLMADELKVGLEVERDEKGWVSKEKLSEAITCVMDKGNELGCSLRNNHSEWR GVVSDPDFMSSYIDKFVQNLHDLVK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G27570			UDP-Glycosyltransferase superf...		Lus10013368 [exp]	0	1
AT4G16295		SPH1	S-protein homologue 1 (.1)		Lus10000558 [exp]	3.2	1.0000
AT3G51590		LTP12	lipid transfer protein 12 (.1)		Lus10004067 [exp]	4.5	1.0000
AT1G24260	MADS	AGL9, SEP3	SEPALLATA3, AGAMOUS-like 9, K-...		Lus10015765 [exp]	4.8	1.0000
AT1G17930			Aminotransferase-like, plant m...		Lus10005482 [exp]	5.5	1.0000
					Lus10011636 [exp]	6.3	1.0000
AT3G16970			Plant self-incompatibility pro...		Lus10011753 [exp]	7.1	1.0000
AT4G16295		SPH1	S-protein homologue 1 (.1)		Lus10011892 [exp]	7.7	1.0000
AT2G32940		AGO6	ARGONAUTE 6, Argonaute family ...		Lus10015155 [exp]	8.0	0.9983
AT3G18990	B3	REM39, VRN1	REDUCED VERNALIZATION RESPONSE...		Lus10022473 [exp]	8.4	1.0000
AT4G10950			SGNH hydrolase-type esterase s...		Lus10023070 [exp]	8.9	1.0000

Compare expression of checked genes

Lus10013368 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.