Lus10013382 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G20935 130 / 3e-40 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008436 207 / 2e-67 AT3G11940 371 / 3e-130 ARABIDOPSIS MINUTE-LIKE 1, ribosomal protein 5A (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G155300 131 / 2e-40 AT5G20935 130 / 3e-40 unknown protein
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF11347 DUF3148 Protein of unknown function (DUF3148)
Representative CDS sequence
>Lus10013382 pacid=23151379 polypeptide=Lus10013382 locus=Lus10013382.g ID=Lus10013382.BGIv1.0 annot-version=v1.0
ATGGCGGCCTTATCTTTCTCATCCTCCGCCACAATCTCATCAAATTGCCACCGCAGCCTGGTCTTCCAATCTGGACACAGAACTGCGGTCGCAATCCGAT
GCGGAGCAGACGAATCGACGTCGCCGGGAAATAATAAGATAGCTATTAGCAGCTCCCAAGAACCGGCCAGGAAATCGAGTCTCCAGATTGGCTCTCCGGT
GGTAGTAATTGAGTCGCCGAAGATAATAAAAACCGCCGCATCCGTGCCTTGCCTGCAAGTCAATGTCGGGCTCGTTAACCCTGGAGACGTCGGCAGAATA
GTATCGAGGAAGCCGAAGGATGTGTGGGCAGTTCGTCTGGCGATCGGAACGTATTTGATCGATGGCAAGTATTTCCAGCCATTGGAGCTCGATGACTGA
AA sequence
>Lus10013382 pacid=23151379 polypeptide=Lus10013382 locus=Lus10013382.g ID=Lus10013382.BGIv1.0 annot-version=v1.0
MAALSFSSSATISSNCHRSLVFQSGHRTAVAIRCGADESTSPGNNKIAISSSQEPARKSSLQIGSPVVVIESPKIIKTAASVPCLQVNVGLVNPGDVGRI
VSRKPKDVWAVRLAIGTYLIDGKYFQPLELDD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G20935 unknown protein Lus10013382 0 1
AT4G34350 HDR, CLB6, ISPH CHLOROPLAST BIOGENESIS 6, 4-hy... Lus10042345 2.0 0.9472
AT4G10300 RmlC-like cupins superfamily p... Lus10035659 2.4 0.9255
AT3G18870 Mitochondrial transcription te... Lus10026325 2.4 0.9377
AT2G36270 bZIP EEL, GIA1, ABI5 GROWTH-INSENSITIVITY TO ABA 1,... Lus10014194 4.2 0.9071
AT1G44920 unknown protein Lus10007720 7.3 0.9183
AT2G37920 EMB1513 embryo defective 1513, copper ... Lus10024339 7.5 0.9074
AT5G16720 Protein of unknown function, D... Lus10010755 7.7 0.9030
AT4G25910 ATCNFU3, NFU3 NFU domain protein 3 (.1) Lus10001439 8.4 0.9185
AT4G31560 HCF153 high chlorophyll fluorescence ... Lus10005314 8.7 0.9237
AT4G38225 unknown protein Lus10026560 10.5 0.9053

Lus10013382 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.