Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G43610 70 / 3e-15 Spc97 / Spc98 family of spindle pole body (SBP) component (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008428 [exp] 99 / 2e-25 AT3G43610 715 / 0.0 Spc97 / Spc98 family of spindle pole body (SBP) component (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G153300 [exp] 92 / 4e-23 AT3G43610 855 / 0.0 Spc97 / Spc98 family of spindle pole body (SBP) component (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10013394 pacid=23151405 polypeptide=Lus10013394 locus=Lus10013394.g ID=Lus10013394.BGIv1.0 annot-version=v1.0 ATGATGGATCTGGAATTGGTGCACATAACATATCTTACCGACTCTTTGGACATATGTTTTCTCTCTGAAGAAGCGCGGGGCGTAGCTGGCATCATTGAAA ACATGTTGCAGTGTGCCTTGGATTTCAAGTCTTGCATTATAAGTGCCATGAGCGATGTTAGGTTGGACCATGCAAGCTTGTCCAGCAAGCTGTCTAAGAT CAACGTGTCACAGGATGGGTATTACCTGTACCCAAAACTACAACGGCTGAGGAACGGATATCAACTATCTGAACACGAACCCGGACCTGATCGTTGTCAA CCCTTAAAATACAACTAA
AA sequence Show only first row Show all	>Lus10013394 pacid=23151405 polypeptide=Lus10013394 locus=Lus10013394.g ID=Lus10013394.BGIv1.0 annot-version=v1.0 MMDLELVHITYLTDSLDICFLSEEARGVAGIIENMLQCALDFKSCIISAMSDVRLDHASLSSKLSKINVSQDGYYLYPKLQRLRNGYQLSEHEPGPDRCQ PLKYN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G43610			Spc97 / Spc98 family of spindl...		Lus10013394 [exp]	0	1
AT5G35170			adenylate kinase family protei...		Lus10019071 [exp]	11.3	0.7607
					Lus10000538 [exp]	12.6	0.7780
					Lus10038789 [exp]	13.8	0.6694
AT3G45140		ATLOX2, LOX2	ARABIODOPSIS THALIANA LIPOXYGE...		Lus10002545 [exp]	24.1	0.7826
AT5G39940			FAD/NAD(P)-binding oxidoreduct...		Lus10001121 [exp]	27.4	0.7642
AT4G33270		AtCDC20.1, CDC2...	cell division cycle 20.1, Tran...		Lus10017848 [exp]	27.9	0.7338
AT5G59800		ATMBD7, MBD7	ARABIDOPSIS THALIANA METHYL-CP...		Lus10040859 [exp]	34.5	0.7736
AT3G45070			P-loop containing nucleoside t...		Lus10041611 [exp]	37.9	0.7533
AT4G00020		BRCA2(IV), BRCA...	MATERNAL EFFECT EMBRYO ARREST ...		Lus10017785 [exp]	48.0	0.7332
AT4G12910		SCPL20	serine carboxypeptidase-like 2...		Lus10009562 [exp]	49.7	0.7600

Compare expression of checked genes

Lus10013394 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.