Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G21300 66 / 1e-13 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G08820 62 / 2e-12 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G13770 62 / 2e-12 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT2G34400 62 / 2e-12 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT3G03580 60 / 9e-12 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT2G41080 57 / 8e-11 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G09410 57 / 9e-11 pentatricopeptide (PPR) repeat-containing protein (.1) AT3G46790 57 / 9e-11 CRR2 CHLORORESPIRATORY REDUCTION 2, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G21065 56 / 2e-10 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) AT3G63370 56 / 2e-10 OTP86 ORGANELLE TRANSCRIPT PROCESSING 86, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010320 [exp] 177 / 7e-54 AT2G34400 658 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Lus10031423 [exp] 65 / 2e-13 AT5G66520 538 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10029436 [exp] 64 / 3e-13 AT3G08820 828 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10010909 [exp] 64 / 4e-13 AT5G66520 537 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10031989 [exp] 64 / 7e-13 AT3G26782 865 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10029344 [exp] 60 / 1e-11 AT5G06540 803 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10005207 [exp] 60 / 1e-11 AT4G21065 741 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Lus10008967 [exp] 59 / 2e-11 AT4G21300 876 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10013319 [exp] 59 / 4e-11 AT4G21065 744 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G108000 [exp] 127 / 1e-35 AT2G34400 640 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.018G145510 [exp] 82 / 2e-19 AT2G34400 462 / 3e-158 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.018G145514 [exp] 80 / 1e-18 AT2G34400 472 / 4e-162 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.006G105700 [exp] 68 / 1e-14 AT3G08820 810 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.013G005400 [exp] 65 / 2e-13 AT1G56690 1018 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.002G021300 [exp] 63 / 8e-13 AT1G20230 852 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.016G128900 [exp] 63 / 9e-13 AT3G08820 812 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.005G012600 [exp] 63 / 1e-12 AT2G29760 540 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.003G031600 [exp] 62 / 2e-12 AT3G15930 784 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.005G006400 [exp] 62 / 2e-12 AT1G56690 993 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10013405 pacid=23155072 polypeptide=Lus10013405 locus=Lus10013405.g ID=Lus10013405.BGIv1.0 annot-version=v1.0 ATGCCCAAGTGGACTGATGACTCTGTTTTTCATTTTATTGTCCTGGGAGCATTGCTCGCTGCTTGTCGGAAAAGAAAGAATGAAGATGTCAGTGAACGGG TGATTAAACTACTTCTAGAGGTGGAGCCATCAAATTCTGGGAACTACGTTATATCATCTAAGATATATGCTGATATGAGAAGATGTTGGGTTGAGCTGGG ATCTCAAGTTCATGAATTTCATGCTGGCGATAGTTTACCAGATCAATCGGTACGTATGTACCAACTGCTCAATGAGCAGATGAGGAAAGAAGGTTACGTT CCAAAGCCTGATTCTTCTTAG
AA sequence Show only first row Show all	>Lus10013405 pacid=23155072 polypeptide=Lus10013405 locus=Lus10013405.g ID=Lus10013405.BGIv1.0 annot-version=v1.0 MPKWTDDSVFHFIVLGALLAACRKRKNEDVSERVIKLLLEVEPSNSGNYVISSKIYADMRRCWVELGSQVHEFHAGDSLPDQSVRMYQLLNEQMRKEGYV PKPDSS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G21300			Tetratricopeptide repeat (TPR)...		Lus10013405 [exp]	0	1
AT3G18990	B3	REM39, VRN1	REDUCED VERNALIZATION RESPONSE...		Lus10021007 [exp]	4.2	0.7237
					Lus10022112 [exp]	5.8	0.7150
AT1G58520		RXW8	lipases;hydrolases, acting on ...		Lus10036752 [exp]	8.0	0.6189
					Lus10001546 [exp]	8.7	0.6970
AT1G09600			Protein kinase superfamily pro...		Lus10028890 [exp]	8.8	0.7132
AT1G01280		CYP703A2	"cytochrome P450, family 703, ...		Lus10010119 [exp]	13.4	0.6836
AT4G04960			Concanavalin A-like lectin pro...		Lus10039837 [exp]	14.7	0.6836
AT5G39130			RmlC-like cupins superfamily p...		Lus10015129 [exp]	15.9	0.6836
AT5G01180		ATPTR5	ARABIDOPSIS THALIANA PEPTIDE T...		Lus10017177 [exp]	17.0	0.6836
					Lus10017294 [exp]	18.0	0.6836

Compare expression of checked genes

Lus10013405 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.