Lus10013407 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010318 130 / 3e-40 AT3G13480 47 / 4e-07 unknown protein
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10013407 pacid=23155105 polypeptide=Lus10013407 locus=Lus10013407.g ID=Lus10013407.BGIv1.0 annot-version=v1.0
ATGAGGGTAGTGGCGTGCAACATCCACAGTCCTTTGCTTTGCTTGTGCAAGTGCAACGCATCAGATAGCATCTGCAGCCATCATCAGGTGCCAGCTTGTT
CAATCTCATCAACTGATGAGAACATTCAACCCAAAGAGGAGAAGAAGGAAGGAGGAAAAGAGGAGAAGAGGAGGAGTTGCATTGCAAGCCAAGCTGCCTC
GGGAGAGAAGGATAATGATAATAAGAAGAAGCATAAGAAGAAAGTGCAGTGGATGGATTTGGTTGGGAAACCACTGTTCGAGATCAGAGAATTTGAACTC
ACCAGGTTTTAA
AA sequence
>Lus10013407 pacid=23155105 polypeptide=Lus10013407 locus=Lus10013407.g ID=Lus10013407.BGIv1.0 annot-version=v1.0
MRVVACNIHSPLLCLCKCNASDSICSHHQVPACSISSTDENIQPKEEKKEGGKEEKRRSCIASQAASGEKDNDNKKKHKKKVQWMDLVGKPLFEIREFEL
TRF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G13480 unknown protein Lus10013407 0 1
AT4G13940 MEE58, EMB1395,... MATERNAL EFFECT EMBRYO ARREST ... Lus10043156 7.0 0.9529
AT1G05060 unknown protein Lus10030021 8.2 0.9499
AT4G13010 Oxidoreductase, zinc-binding d... Lus10025898 12.3 0.9407
AT1G05060 unknown protein Lus10035303 13.7 0.9355
AT4G21410 CRK29 cysteine-rich RLK (RECEPTOR-li... Lus10007635 14.1 0.8834
AT1G58070 unknown protein Lus10015482 14.6 0.9466
AT3G16210 F-box family protein (.1) Lus10015408 14.8 0.9204
AT3G54450 Major facilitator superfamily ... Lus10024156 16.6 0.9380
AT1G32100 ATPRR1 pinoresinol reductase 1 (.1) Lus10012143 22.8 0.9401
AT2G03220 ATFUT1, ATFT1, ... MURUS 2, ARABIDOPSIS THALIANA ... Lus10013549 25.8 0.9311

Lus10013407 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.