Lus10013414 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10013414 pacid=23155089 polypeptide=Lus10013414 locus=Lus10013414.g ID=Lus10013414.BGIv1.0 annot-version=v1.0
ATGACTTCAAGCCATGATCCATCACCGGGTAGGTGTCTTAGGGCGAATATCGGGCCTAAGGTGAGTGGTCTCCGATCTCCTGCATGCCATGAAGGTAAGG
TAGGACGCGAAGAAGAAGCTGCTGAAGCAGAGAAAGCTCATTTCCCTGCTTTCCACAGTGTAGCCAAAATGGAAAGCCGGGATTGTGCTCATGGCGTTCA
CCCATCGCTGCAATTGGCTGCGGATCTTATTTCGTTGCTTAGCCAGTTTTCTGATCCTGGTAAATTGCTTTCCTGA
AA sequence
>Lus10013414 pacid=23155089 polypeptide=Lus10013414 locus=Lus10013414.g ID=Lus10013414.BGIv1.0 annot-version=v1.0
MTSSHDPSPGRCLRANIGPKVSGLRSPACHEGKVGREEEAAEAEKAHFPAFHSVAKMESRDCAHGVHPSLQLAADLISLLSQFSDPGKLLS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10013414 0 1
AT5G39130 RmlC-like cupins superfamily p... Lus10015129 4.9 0.7726
AT1G01280 CYP703A2 "cytochrome P450, family 703, ... Lus10010119 6.9 0.7726
AT5G01180 ATPTR5 ARABIDOPSIS THALIANA PEPTIDE T... Lus10017177 8.5 0.7726
Lus10017294 9.8 0.7726
AT4G04960 Concanavalin A-like lectin pro... Lus10039837 11.0 0.7726
AT1G48020 ATPMEI1 ARABIDOPSIS THALIANA PECTIN ME... Lus10001658 12.0 0.7726
Lus10003941 13.0 0.7726
Lus10001546 13.5 0.7068
AT1G04110 SDD1 STOMATAL DENSITY AND DISTRIBUT... Lus10027892 13.9 0.7726
AT1G29050 TBL38 TRICHOME BIREFRINGENCE-LIKE 38... Lus10039560 14.7 0.7726

Lus10013414 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.