Plant FIBer expression Database

Lus10013424 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G36120 149 / 7e-47 atylmg3, CCB3 "cofactor assembly, complex C \(B6F\)", cofactor assembly, complex C (B6F) (.1)
AT5G21920 39 / 0.0004 ATYLMG2 YGGT family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040969
[exp]
203 / 4e-65 AT3G19800 197 / 4e-61 Protein of unknown function (DUF177) (.1), Protein of unknown function (DUF177) (.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G062100
[exp]
149 / 5e-46 AT5G36120 184 / 2e-59 "cofactor assembly, complex C \(B6F\)", cofactor assembly, complex C (B6F) (.1)
Potri.005G199000
[exp]
143 / 6e-44 AT5G36120 181 / 4e-58 "cofactor assembly, complex C \(B6F\)", cofactor assembly, complex C (B6F) (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02325 YGGT YGGT family
Representative CDS sequence
>Lus10013424 pacid=23155128 polypeptide=Lus10013424 locus=Lus10013424.g ID=Lus10013424.BGIv1.0 annot-version=v1.0
ATGGCCAAGCCCAGCCCACTAAGAAGACGACTTGGCTTCCGGACATTTACTACTCACAGATCTTCCAATACTTTCCCGGACCACTACACACAGCTGGGAC
TGGGAGCATGGATGGTGGAAGCTGATATTGACCCGGCCACTGCCAAACTTGCAATTGCCTTTCTGGGGCCATTCCTCTCAGGGCTATCCTTTCTTTTCAT
TGTCAGGATTGTCATGTCTTGGTATCCAAAGCTTCCAGTCGACAAGTTCCCTTATGTTGTTGCCTATGCTCCCACGGAACCAATTCTCGCAGTGACTCGT
AAAGTCATCCAGCCGCTTGGCGGAGTCGATGTGACTCCTGTGGTTTGGTTCGGCTTGATCAGCTTCCTCAACGAGATACTCGTTGGCCCCCAGGGGCTTC
TGGTTCTCATTTCACAACAAGTTGGCTGA
AA sequence
>Lus10013424 pacid=23155128 polypeptide=Lus10013424 locus=Lus10013424.g ID=Lus10013424.BGIv1.0 annot-version=v1.0
MAKPSPLRRRLGFRTFTTHRSSNTFPDHYTQLGLGAWMVEADIDPATAKLAIAFLGPFLSGLSFLFIVRIVMSWYPKLPVDKFPYVVAYAPTEPILAVTR
KVIQPLGGVDVTPVVWFGLISFLNEILVGPQGLLVLISQQVG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G36120 atylmg3, CCB3 "cofactor assembly, complex C ... Lus10013424
[exp]
0 1
AT3G23760 unknown protein Lus10043212
[exp]
1.4 0.9279
AT4G11175 Nucleic acid-binding, OB-fold-... Lus10035773
[exp]
2.0 0.9391
AT3G21200 PGR7 proton gradient regulation 7 (... Lus10035751
[exp]
2.8 0.9121
AT3G53170 Tetratricopeptide repeat (TPR)... Lus10024893
[exp]
4.5 0.9225
AT5G13510 EMB3136 EMBRYO DEFECTIVE 3136, Ribosom... Lus10001982
[exp]
4.6 0.9278
AT5G55740 CRR21 chlororespiratory reduction 21... Lus10004751
[exp]
6.0 0.9119
Lus10040882
[exp]
6.0 0.9249
AT4G27990 ATYLMG1-2 YGGT family protein (.1) Lus10009586
[exp]
7.7 0.9108
AT5G16710 DHAR3 dehydroascorbate reductase 1 (... Lus10028510
[exp]
8.8 0.9101
AT5G08370 ATAGAL2 alpha-galactosidase 2 (.1.2) Lus10038305
[exp]
9.2 0.8904

Lus10013424 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.