Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G23140 346 / 5e-121 NCLPP7, NCLPP2, CLPP2 nuclear-encoded CLP protease P7 (.1) AT1G02560 188 / 3e-58 NCLPP5, NCLPP1, CLPP5 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1) AT1G66670 176 / 2e-53 NCLPP3, NCLPP4, CLPP3 CLP protease proteolytic subunit 3 (.1) ATCG00670 159 / 2e-48 PCLPP, ATCG00670.1, CLPP1 CASEINOLYTIC PROTEASE P 1, plastid-encoded CLP P (.1) AT5G45390 162 / 5e-48 NCLPP3, NCLPP4, CLPP4 NUCLEAR-ENCODED CLP PROTEASE P4, CLP protease P4 (.1) AT1G11750 150 / 5e-44 NCLPP6, NCLPP1, CLPP6 NUCLEAR-ENCODED CLPP 1, CLP protease proteolytic subunit 6 (.1.2) AT4G17040 149 / 4e-43 HON5, CLPR4 happy on norflurazon 5, CLP protease R subunit 4 (.1) AT1G12410 140 / 4e-40 EMB3146, CLP2, NCLPP2, CLPR2 NUCLEAR-ENCODED CLP PROTEASE P2, EMBRYO DEFECTIVE 3146, CLP protease proteolytic subunit 2 (.1) AT1G09130 123 / 5e-33 ATP-dependent caseinolytic (Clp) protease/crotonase family protein (.1), ATP-dependent caseinolytic (Clp) protease/crotonase family protein (.2), ATP-dependent caseinolytic (Clp) protease/crotonase family protein (.3) AT1G49970 96 / 1e-22 SVR2, NCLPP5, CLPR1 SUPPRESSOR OF VARIEGATION 2, NUCLEAR CLPP 5, CLP protease proteolytic subunit 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040981 [exp] 564 / 0 AT5G23140 350 / 1e-122 nuclear-encoded CLP protease P7 (.1) Lus10040982 [exp] 407 / 3e-144 AT5G23140 338 / 5e-118 nuclear-encoded CLP protease P7 (.1) Lus10010196 [exp] 339 / 4e-118 AT5G23140 395 / 4e-141 nuclear-encoded CLP protease P7 (.1) Lus10017397 [exp] 335 / 2e-116 AT5G23140 394 / 1e-140 nuclear-encoded CLP protease P7 (.1) Lus10013435 [exp] 292 / 4e-98 AT5G23140 209 / 5e-66 nuclear-encoded CLP protease P7 (.1) Lus10002422 [exp] 169 / 5e-51 AT1G02560 361 / 4e-126 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1) Lus10001450 [exp] 169 / 5e-50 AT1G02560 365 / 1e-126 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1) Lus10000063 [exp] 153 / 5e-47 AT5G23140 128 / 2e-38 nuclear-encoded CLP protease P7 (.1) Lus10025022 [exp] 157 / 5e-46 AT1G02560 313 / 3e-107 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G071700 [exp] 347 / 1e-120 AT5G23140 383 / 1e-135 nuclear-encoded CLP protease P7 (.1) Potri.005G092600 [exp] 342 / 2e-119 AT5G23140 380 / 3e-135 nuclear-encoded CLP protease P7 (.1) Potri.002G195200 [exp] 188 / 2e-58 AT1G02560 474 / 2e-170 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1) Potri.014G119700 [exp] 188 / 4e-58 AT1G02560 493 / 6e-178 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1) Potri.004G092100 [exp] 179 / 3e-54 AT1G66670 441 / 2e-156 CLP protease proteolytic subunit 3 (.1) Potri.003G103300 [exp] 164 / 5e-49 AT5G45390 383 / 9e-135 NUCLEAR-ENCODED CLP PROTEASE P4, CLP protease P4 (.1) Potri.004G152900 [exp] 156 / 4e-46 AT1G11750 397 / 4e-141 NUCLEAR-ENCODED CLPP 1, CLP protease proteolytic subunit 6 (.1.2) Potri.009G114001 [exp] 154 / 3e-45 AT1G11750 353 / 2e-123 NUCLEAR-ENCODED CLPP 1, CLP protease proteolytic subunit 6 (.1.2) Potri.001G115900 [exp] 140 / 5e-40 AT1G12410 408 / 3e-145 NUCLEAR-ENCODED CLP PROTEASE P2, EMBRYO DEFECTIVE 3146, CLP protease proteolytic subunit 2 (.1) Potri.003G083300 [exp] 140 / 2e-39 AT4G17040 441 / 2e-157 happy on norflurazon 5, CLP protease R subunit 4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0127 [flax] [poplar] ClpP_crotonase PF00574 [flax] [poplar] CLP_protease Clp protease
Representative CDS sequence Show only first row Show all	>Lus10013434 pacid=23155135 polypeptide=Lus10013434 locus=Lus10013434.g ID=Lus10013434.BGIv1.0 annot-version=v1.0 ATGAACTACTCAAGCTCAACCCTCACCTCACGACCTCAATTCGTTATCCCTACCTCCCAGCGACCTCTCCTCCATGGCGTCCGCCTTCCTCCGTCCTCCG CCGGTCTCTTCGCCTCCAACCCCATCCTCGATAGCACCTCCAACAGGACCGCCTCCCTCAACGCCAAATTCCGCCCCAATAGTCTCATCCCTATGGTCGT CGAACAAACCTCCCGCGGTGAGAGATCCTACGACATCTTCTCCAGACTTCTCAAGGAACGGATTGTCTATATCAACGGTCCCATTATGGACGATACTGCT CACGTCGTCGTTGCTCAGCTCCTCTTCCTCGAGTCCGAGAGTAATACCAAGCCTATCTCCATGTACCTCAACTCCCCCGGCGGCTCTGTCACTGCAGGTC TTGCCATCTACGACACGATGCAGTTCATTAGGGCGCCAGTGCACACAACATGCATGGGACTGGCTGCATCAATGGGTTCTCTTCTTTTGACTGCTGGAGC CAAGGGTGAGAGGAGGGCACTTCCAAATGCGACAGTGATGATTCATCAACCATCTGGAGGGTACCAAGGGCAAGCCAAGGATATGACAATCCACACGCAG CATATAATTCGCGTCTGGGATAATCTTAATAGGCTGTACGTAAAGCATACGGGGCAGCCATTAGATGTAATCGCGAAGAATATGGACAGGGATAATTTTA TGACCCCTGATGAAGCTAAGGATTTCGGGCTGATTGACGAGGTGGTCGAACGTAAGCCGTTGGATTTGATAACTGGTGCTTTTGGACAAGGAAGGCCGTC AGTAGGAGGAGGAGGAGGAGGGTTGGATCCAAGTCCAGAGGAGAAGATTTCCACAGAATGA
AA sequence Show only first row Show all	>Lus10013434 pacid=23155135 polypeptide=Lus10013434 locus=Lus10013434.g ID=Lus10013434.BGIv1.0 annot-version=v1.0 MNYSSSTLTSRPQFVIPTSQRPLLHGVRLPPSSAGLFASNPILDSTSNRTASLNAKFRPNSLIPMVVEQTSRGERSYDIFSRLLKERIVYINGPIMDDTA HVVVAQLLFLESESNTKPISMYLNSPGGSVTAGLAIYDTMQFIRAPVHTTCMGLAASMGSLLLTAGAKGERRALPNATVMIHQPSGGYQGQAKDMTIHTQ HIIRVWDNLNRLYVKHTGQPLDVIAKNMDRDNFMTPDEAKDFGLIDEVVERKPLDLITGAFGQGRPSVGGGGGGLDPSPEEKISTE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G23140		NCLPP7, NCLPP2,...	nuclear-encoded CLP protease P...		Lus10013434 [exp]	0	1
AT5G23140		NCLPP7, NCLPP2,...	nuclear-encoded CLP protease P...		Lus10040981 [exp]	1.0	0.9734
AT1G21065			unknown protein		Lus10016049 [exp]	2.0	0.9198
AT3G18280			Bifunctional inhibitor/lipid-t...		Lus10033574 [exp]	6.2	0.8792
AT2G27290			Protein of unknown function (D...		Lus10005208 [exp]	7.5	0.9044
AT2G20920			Protein of unknown function (D...		Lus10027826 [exp]	8.9	0.8851
AT4G38225			unknown protein		Lus10013843 [exp]	10.0	0.9010
AT4G22120			ERD (early-responsive to dehyd...		Lus10020032 [exp]	10.1	0.8262
AT3G18280			Bifunctional inhibitor/lipid-t...		Lus10017616 [exp]	10.8	0.8627
AT4G32260		PDE334	PIGMENT DEFECTIVE 334, ATPase,...		Lus10006188 [exp]	17.0	0.8974
AT5G08410		FTRA2	ferredoxin/thioredoxin reducta...		Lus10041002 [exp]	18.7	0.8909

Compare expression of checked genes

Lus10013434 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.