Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G08250 87 / 8e-22 Cytochrome P450 superfamily protein (.1) AT5G23190 85 / 6e-21 CYP86B1 "cytochrome P450, family 86, subfamily B, polypeptide 1", cytochrome P450, family 86, subfamily B, polypeptide 1 (.1) AT4G00360 62 / 5e-13 ATT1, CYP86A2 "cytochrome P450, family 86, subfamily A, polypeptide 2", ABERRANT INDUCTION OF TYPE THREE 1, cytochrome P450, family 86, subfamily A, polypeptide 2 (.1) AT2G45970 62 / 5e-13 CYP86A8, LCR LACERATA, "cytochrome P450, family 86, subfamily A, polypeptide 8", cytochrome P450, family 86, subfamily A, polypeptide 8 (.1) AT1G01600 62 / 8e-13 CYP86A4 "cytochrome P450, family 86, subfamily A, polypeptide 4", cytochrome P450, family 86, subfamily A, polypeptide 4 (.1) AT1G13150 61 / 1e-12 CYP86C4 "cytochrome P450, family 86, subfamily C, polypeptide 4", cytochrome P450, family 86, subfamily C, polypeptide 4 (.1) AT1G24540 61 / 2e-12 CYP86C1 "cytochrome P450, family 86, subfamily C, polypeptide 1", cytochrome P450, family 86, subfamily C, polypeptide 1 (.1) AT1G13140 60 / 3e-12 CYP86C3 "cytochrome P450, family 86, subfamily C, polypeptide 3", cytochrome P450, family 86, subfamily C, polypeptide 3 (.1.2) AT3G26125 58 / 1e-11 CYP86C2 "cytochrome P450, family 86, subfamily C, polypeptide 2", cytochrome P450, family 86, subfamily C, polypeptide 2 (.1) AT1G63710 57 / 2e-11 CYP86A7 "cytochrome P450, family 86, subfamily A, polypeptide 7", cytochrome P450, family 86, subfamily A, polypeptide 7 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006232 [exp] 61 / 2e-12 AT1G24540 524 / 0.0 "cytochrome P450, family 86, subfamily C, polypeptide 1", cytochrome P450, family 86, subfamily C, polypeptide 1 (.1) Lus10032278 [exp] 60 / 3e-12 AT1G63710 792 / 0.0 "cytochrome P450, family 86, subfamily A, polypeptide 7", cytochrome P450, family 86, subfamily A, polypeptide 7 (.1) Lus10018831 [exp] 60 / 4e-12 AT4G00360 403 / 8e-139 "cytochrome P450, family 86, subfamily A, polypeptide 2", ABERRANT INDUCTION OF TYPE THREE 1, cytochrome P450, family 86, subfamily A, polypeptide 2 (.1) Lus10014768 [exp] 60 / 4e-12 AT4G00360 756 / 0.0 "cytochrome P450, family 86, subfamily A, polypeptide 2", ABERRANT INDUCTION OF TYPE THREE 1, cytochrome P450, family 86, subfamily A, polypeptide 2 (.1) Lus10038896 [exp] 60 / 5e-12 AT2G45510 582 / 0.0 "cytochrome P450, family 704, subfamily A, polypeptide 2", cytochrome P450, family 704, subfamily A, polypeptide 2 (.1) Lus10015018 [exp] 59 / 1e-11 AT2G45510 586 / 0.0 "cytochrome P450, family 704, subfamily A, polypeptide 2", cytochrome P450, family 704, subfamily A, polypeptide 2 (.1) Lus10009232 [exp] 58 / 1e-11 AT2G45510 639 / 0.0 "cytochrome P450, family 704, subfamily A, polypeptide 2", cytochrome P450, family 704, subfamily A, polypeptide 2 (.1) Lus10036880 [exp] 55 / 1e-11 AT1G24540 102 / 9e-27 "cytochrome P450, family 86, subfamily C, polypeptide 1", cytochrome P450, family 86, subfamily C, polypeptide 1 (.1) Lus10024644 [exp] 57 / 3e-11 AT1G63710 562 / 0.0 "cytochrome P450, family 86, subfamily A, polypeptide 7", cytochrome P450, family 86, subfamily A, polypeptide 7 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G072100 [exp] 86 / 2e-21 AT5G23190 799 / 0.0 "cytochrome P450, family 86, subfamily B, polypeptide 1", cytochrome P450, family 86, subfamily B, polypeptide 1 (.1) Potri.005G092200 [exp] 84 / 2e-20 AT5G23190 788 / 0.0 "cytochrome P450, family 86, subfamily B, polypeptide 1", cytochrome P450, family 86, subfamily B, polypeptide 1 (.1) Potri.008G183300 [exp] 65 / 5e-14 AT1G24540 682 / 0.0 "cytochrome P450, family 86, subfamily C, polypeptide 1", cytochrome P450, family 86, subfamily C, polypeptide 1 (.1) Potri.010G050100 [exp] 63 / 3e-13 AT1G24540 684 / 0.0 "cytochrome P450, family 86, subfamily C, polypeptide 1", cytochrome P450, family 86, subfamily C, polypeptide 1 (.1) Potri.014G085800 [exp] 61 / 2e-12 AT2G45970 866 / 0.0 LACERATA, "cytochrome P450, family 86, subfamily A, polypeptide 8", cytochrome P450, family 86, subfamily A, polypeptide 8 (.1) Potri.014G072100 [exp] 57 / 4e-11 AT2G45510 563 / 0.0 "cytochrome P450, family 704, subfamily A, polypeptide 2", cytochrome P450, family 704, subfamily A, polypeptide 2 (.1) Potri.016G031850 [exp] 55 / 4e-11 AT3G56630 221 / 4e-71 "cytochrome P450, family 94, subfamily D, polypeptide 2", cytochrome P450, family 94, subfamily D, polypeptide 2 (.1) Potri.014G072300 [exp] 56 / 6e-11 AT2G45510 563 / 0.0 "cytochrome P450, family 704, subfamily A, polypeptide 2", cytochrome P450, family 704, subfamily A, polypeptide 2 (.1) Potri.014G072000 [exp] 56 / 1e-10 AT2G45510 706 / 0.0 "cytochrome P450, family 704, subfamily A, polypeptide 2", cytochrome P450, family 704, subfamily A, polypeptide 2 (.1) Potri.003G129100 [exp] 56 / 1e-10 AT1G63710 823 / 0.0 "cytochrome P450, family 86, subfamily A, polypeptide 7", cytochrome P450, family 86, subfamily A, polypeptide 7 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [flax] [poplar] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Lus10013438 pacid=23155169 polypeptide=Lus10013438 locus=Lus10013438.g ID=Lus10013438.BGIv1.0 annot-version=v1.0 ATGAGTTCAAACCGGAGAGATGGCTCGGGCCGGTTCATGAGCGAATCTGCCTACAAGTTCACTGCATTCAACGGGGGCCCTCGTCTGTGTTTGGGTAAGG ACTTTGCTTACTACCAGATGAAGTATGTGGCGGCTTCCATCATGTATCGATCACCCAGTCACCCCGAAGCTCGCATTGACCATGTACATGAAACATGGGC TCAAGGTCAACTTGTACAGGAGGTGTACTGA
AA sequence Show only first row Show all	>Lus10013438 pacid=23155169 polypeptide=Lus10013438 locus=Lus10013438.g ID=Lus10013438.BGIv1.0 annot-version=v1.0 MSSNRRDGSGRFMSESAYKFTAFNGGPRLCLGKDFAYYQMKYVAASIMYRSPSHPEARIDHVHETWAQGQLVQEVY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G08250			Cytochrome P450 superfamily pr...		Lus10013438 [exp]	0	1
AT2G31580			tRNAHis guanylyltransferase (....		Lus10006155 [exp]	3.7	0.9380
AT5G60970	TCP	TCP5	TEOSINTE BRANCHED 1, cycloidea...		Lus10017856 [exp]	4.0	0.9347
AT1G13290	C2H2ZnF	WIP6, DOT5	WIP domain protein 6, DEFECTIV...		Lus10021700 [exp]	4.0	0.9280
AT2G01770		ATVIT1, VIT1	vacuolar iron transporter 1 (....		Lus10021809 [exp]	5.9	0.9247
AT3G47570			Leucine-rich repeat protein ki...		Lus10037311 [exp]	6.6	0.9098
					Lus10008697 [exp]	7.1	0.9297
AT4G37810			unknown protein		Lus10007240 [exp]	8.9	0.9123
AT2G32180		PTAC18	plastid transcriptionally acti...		Lus10030017 [exp]	9.8	0.9240
AT5G18880			RNA-directed DNA polymerase (r...		Lus10023044 [exp]	17.0	0.8955
AT5G10770			Eukaryotic aspartyl protease f...		Lus10026243 [exp]	17.2	0.8458

Compare expression of checked genes

Lus10013438 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.