Lus10013448 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G08410 129 / 1e-38 FTRA2 ferredoxin/thioredoxin reductase subunit A (variable subunit) 2 (.1)
AT5G23440 119 / 9e-35 FTRA1 ferredoxin/thioredoxin reductase subunit A (variable subunit) 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041002 275 / 2e-96 AT5G08410 130 / 8e-39 ferredoxin/thioredoxin reductase subunit A (variable subunit) 2 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G002200 112 / 5e-32 AT5G08410 103 / 3e-28 ferredoxin/thioredoxin reductase subunit A (variable subunit) 2 (.1)
Potri.010G255500 103 / 1e-28 AT5G08410 78 / 4e-18 ferredoxin/thioredoxin reductase subunit A (variable subunit) 2 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0610 ETAP PF02941 FeThRed_A Ferredoxin thioredoxin reductase variable alpha chain
Representative CDS sequence
>Lus10013448 pacid=23155130 polypeptide=Lus10013448 locus=Lus10013448.g ID=Lus10013448.BGIv1.0 annot-version=v1.0
ATGAGTTTTTGTGCGTCCTCCTCCTCCACTGCCGCCACCGCCGTTCTAGGCCTTCTGCCTTCTCCCCGGCCTACTACTCGAATCCTCCCGCCACTCTCCT
CCACTCCTCCTTCTGTTCGGAAGCATAATCGGAAGCTGGTGGTCTCATGCGAAGTGGCCGTCCGGTCGTCGAACGAATCCTCCGCCAAATCGGATCCCCA
ACAGCAAGAAGAGCAGCATAAGATTGGAGCGAGGGTGAGAGTGAAGGTGCCGCTGAAGGTCTACCATGTCCCTAAAGTGCCGGAGGTGGATCTGACTGGC
AAAGAAGGCAAGATCAAGCAGTTCGTCGGGGTTTGGAAGGGCAAGCAAATCTCCGCCAATCTCCCTTACAAGGTAGAATTCTTGTTGGACATCGAAGGTC
GAGACGCACCTGTCAAGCTATTCGCCCATCTCCGGGACGATGAGTTCGAGTACCTTGATTGA
AA sequence
>Lus10013448 pacid=23155130 polypeptide=Lus10013448 locus=Lus10013448.g ID=Lus10013448.BGIv1.0 annot-version=v1.0
MSFCASSSSTAATAVLGLLPSPRPTTRILPPLSSTPPSVRKHNRKLVVSCEVAVRSSNESSAKSDPQQQEEQHKIGARVRVKVPLKVYHVPKVPEVDLTG
KEGKIKQFVGVWKGKQISANLPYKVEFLLDIEGRDAPVKLFAHLRDDEFEYLD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G08410 FTRA2 ferredoxin/thioredoxin reducta... Lus10013448 0 1
AT1G73885 unknown protein Lus10034345 1.7 0.9714
AT5G11840 Protein of unknown function (D... Lus10039247 2.4 0.9687
AT4G04640 ATPC1 ATPase, F1 complex, gamma subu... Lus10002078 2.4 0.9700
AT1G73885 unknown protein Lus10005112 2.8 0.9686
AT3G12345 unknown protein Lus10040344 3.2 0.9616
AT5G38410 Ribulose bisphosphate carboxyl... Lus10017597 3.5 0.9601
AT5G42070 unknown protein Lus10023063 3.7 0.9599
AT5G38410 Ribulose bisphosphate carboxyl... Lus10033558 4.9 0.9599
AT1G44575 CP22, PSBS, NPQ... PHOTOSYSTEM II SUBUNIT S, NONP... Lus10018163 6.3 0.9570
AT1G55480 ZKT protein containing PDZ domain,... Lus10013403 6.7 0.9532

Lus10013448 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.