Lus10013458 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10013458 pacid=23155099 polypeptide=Lus10013458 locus=Lus10013458.g ID=Lus10013458.BGIv1.0 annot-version=v1.0
ATGATGAATTGGACAAGTGTTCAAGTAGCAGTGAAGAGGAGGAAGAAGAAGGCACATGAGCAGTGGTACGGTATGGCCCTCCAGTCCTCCCCTTTCTCTC
TATTCCTCCCATGTGATGTGCCTGCCTGCAATCCGGTGAATGGTGCCGAATCCTCCTTTGTTAGTCAACGCCAACCAATCAGGTTTAGAAACCATTTTCC
CATTCAGCTGTTGTATTGTATTGATGCCCTTTTTATTCACCTGCGTACTCTGGTTATCTTAAGAGTCCACACTCACTTGGGCGACGGCAGGAATGTGAAT
GCTGGACTTGAAGTCCAGTAG
AA sequence
>Lus10013458 pacid=23155099 polypeptide=Lus10013458 locus=Lus10013458.g ID=Lus10013458.BGIv1.0 annot-version=v1.0
MMNWTSVQVAVKRRKKKAHEQWYGMALQSSPFSLFLPCDVPACNPVNGAESSFVSQRQPIRFRNHFPIQLLYCIDALFIHLRTLVILRVHTHLGDGRNVN
AGLEVQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10013458 0 1
AT1G71691 GDSL-like Lipase/Acylhydrolase... Lus10016929 5.5 0.7851
AT3G54400 Eukaryotic aspartyl protease f... Lus10039503 9.5 0.7597
AT3G61610 Galactose mutarotase-like supe... Lus10010131 12.8 0.7361
AT5G27220 Frigida-like protein (.1) Lus10033831 23.6 0.7325
AT3G19300 Protein kinase superfamily pro... Lus10019844 27.6 0.7407
Lus10042511 45.2 0.6904
AT3G58100 PDCB5 plasmodesmata callose-binding ... Lus10002193 52.6 0.7007
AT5G63410 Leucine-rich repeat protein ki... Lus10029659 56.4 0.6769
AT1G62520 unknown protein Lus10032250 57.2 0.6333
AT5G28150 Plant protein of unknown funct... Lus10020240 66.1 0.6650

Lus10013458 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.