Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G10370 110 / 3e-29 SDP6 SUGAR-DEPENDENT 6, FAD-dependent oxidoreductase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007932 [exp] 206 / 4e-70 AT3G10370 135 / 4e-38 SUGAR-DEPENDENT 6, FAD-dependent oxidoreductase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G226700 [exp] 120 / 7e-33 AT3G10370 1007 / 0.0 SUGAR-DEPENDENT 6, FAD-dependent oxidoreductase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0063 [flax] [poplar] NADP_Rossmann PF01266 [flax] [poplar] DAO FAD dependent oxidoreductase
Representative CDS sequence Show only first row Show all	>Lus10013468 pacid=23155160 polypeptide=Lus10013468 locus=Lus10013468.g ID=Lus10013468.BGIv1.0 annot-version=v1.0 ATGTCCAATTCCCGCCACTTTTGGCGCCTCGGCCTCCCTGCTGCCACCGTCCTGGCTTACGGCGGCTCCGTACTCGTCTCCAGTGACCGCGGCGGCGGAG CTGCGGCGGGGCTCGAAGAAGTCAGCAAGAAAATCCATGATCCAAAGGCTTCCGTTCCTTCCCGCGCCGTCCAGGAGTCGGCACTGATCGGCGCCACGGC AGCCAATCCTCTCGACATTCTCGTCGTTGGCGGCGGTGCCACCGGGTGCGGAGTGGCGCTCGACGCCGTCACGAGAGGGCTCCGCGTCGGTCTCGTTGAG AGAGATGATTTCGCTTCCGGGACGTCTTCCAGGTCCACCAAGCTAATTCATGGAGGCAAGTCTATAGATTGA
AA sequence Show only first row Show all	>Lus10013468 pacid=23155160 polypeptide=Lus10013468 locus=Lus10013468.g ID=Lus10013468.BGIv1.0 annot-version=v1.0 MSNSRHFWRLGLPAATVLAYGGSVLVSSDRGGGAAAGLEEVSKKIHDPKASVPSRAVQESALIGATAANPLDILVVGGGATGCGVALDAVTRGLRVGLVE RDDFASGTSSRSTKLIHGGKSID

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G10370		SDP6	SUGAR-DEPENDENT 6, FAD-depende...		Lus10013468 [exp]	0	1
AT4G15415		ATB'GAMMA, ATB'...	Protein phosphatase 2A regulat...		Lus10014618 [exp]	2.0	0.9008
AT3G10370		SDP6	SUGAR-DEPENDENT 6, FAD-depende...		Lus10007932 [exp]	2.4	0.9211
AT3G58050			unknown protein		Lus10016244 [exp]	2.4	0.9155
AT2G25320			TRAF-like family protein (.1)		Lus10001490 [exp]	2.8	0.9218
AT4G39080		VHA-A3	vacuolar proton ATPase A3 (.1)		Lus10017490 [exp]	6.9	0.8955
AT3G26370			O-fucosyltransferase family pr...		Lus10036875 [exp]	6.9	0.8866
AT3G10370		SDP6	SUGAR-DEPENDENT 6, FAD-depende...		Lus10007931 [exp]	7.5	0.8836
AT5G66460		MAN7, AtMAN7	endo-beta-mannase 7, Glycosyl ...		Lus10025995 [exp]	9.8	0.8660
AT1G01220		AtFKGP	Arabidopsis thaliana L-fucokin...		Lus10005982 [exp]	10.5	0.8981
AT5G05660		EBI, ATNFXL2	NFX1-like 2, EARLY BIRD, Arabi...		Lus10028286 [exp]	11.6	0.8829

Compare expression of checked genes

Lus10013468 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.