Lus10013484 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G68040 56 / 2e-10 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
AT1G15125 40 / 9e-05 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007950 145 / 8e-47 AT1G68040 75 / 5e-17 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G136200 96 / 4e-25 AT1G68040 312 / 1e-104 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Potri.008G136300 62 / 1e-12 AT1G68040 379 / 7e-131 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Potri.019G016112 46 / 5e-07 AT1G68040 319 / 2e-107 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Potri.019G016102 45 / 8e-07 AT1G68040 315 / 6e-106 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0063 NADP_Rossmann PF03492 Methyltransf_7 SAM dependent carboxyl methyltransferase
Representative CDS sequence
>Lus10013484 pacid=23155149 polypeptide=Lus10013484 locus=Lus10013484.g ID=Lus10013484.BGIv1.0 annot-version=v1.0
ATGCCACCGCCGGGAGAATTCACAACCGCCATGGCCCAAAACGGCCAGTTCACCGTGGATGCGATGGGGATGACGAATCCTGCGCCGTGGCTGACGGAAG
GAGTCCACGTGGACATGGTGGAATACACGAGCCACATAAGAGACGCCATGGAAGGAATGTTCCTCTCCCATTTCCATCCTAATGTAGTCGGAGCTCTCTT
CGACCGGCTCGCCGTCAAGCTGTTGGAGCCGTCGGAGGAAATGGAGCTGCCGATCTACTCTATTTTACACCGCAATGGTTAG
AA sequence
>Lus10013484 pacid=23155149 polypeptide=Lus10013484 locus=Lus10013484.g ID=Lus10013484.BGIv1.0 annot-version=v1.0
MPPPGEFTTAMAQNGQFTVDAMGMTNPAPWLTEGVHVDMVEYTSHIRDAMEGMFLSHFHPNVVGALFDRLAVKLLEPSEEMELPIYSILHRNG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G68040 S-adenosyl-L-methionine-depend... Lus10013484 0 1
AT2G38870 Serine protease inhibitor, pot... Lus10014740 5.7 0.8084
AT4G25810 XTH23, XTR6 xyloglucan endotransglucosylas... Lus10030484 9.8 0.7245
AT3G61490 Pectin lyase-like superfamily ... Lus10036383 9.8 0.7169
AT1G11920 Pectin lyase-like superfamily ... Lus10018429 13.2 0.7029
Lus10009729 14.0 0.7020
Lus10015218 17.6 0.7094
AT3G21360 2-oxoglutarate (2OG) and Fe(II... Lus10038282 19.6 0.7111
AT5G60900 RLK1 receptor-like protein kinase 1... Lus10032438 20.2 0.5699
AT3G12620 Protein phosphatase 2C family ... Lus10003993 28.1 0.6782
AT1G71050 HIPP20 heavy metal associated isopren... Lus10042946 33.3 0.6720

Lus10013484 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.