Lus10013488 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G15140 245 / 7e-83 FAD/NAD(P)-binding oxidoreductase (.1), FAD/NAD(P)-binding oxidoreductase (.2), FAD/NAD(P)-binding oxidoreductase (.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007955 280 / 5e-99 AT1G15140 236 / 2e-79 FAD/NAD(P)-binding oxidoreductase (.1), FAD/NAD(P)-binding oxidoreductase (.2), FAD/NAD(P)-binding oxidoreductase (.3)
Lus10035265 221 / 3e-68 AT1G15130 836 / 0.0 Endosomal targeting BRO1-like domain-containing protein (.1)
Lus10034633 194 / 1e-62 AT1G15140 316 / 3e-108 FAD/NAD(P)-binding oxidoreductase (.1), FAD/NAD(P)-binding oxidoreductase (.2), FAD/NAD(P)-binding oxidoreductase (.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G126700 241 / 1e-81 AT1G15140 395 / 9e-140 FAD/NAD(P)-binding oxidoreductase (.1), FAD/NAD(P)-binding oxidoreductase (.2), FAD/NAD(P)-binding oxidoreductase (.3)
Potri.010G116500 218 / 7e-72 AT1G15140 368 / 1e-128 FAD/NAD(P)-binding oxidoreductase (.1), FAD/NAD(P)-binding oxidoreductase (.2), FAD/NAD(P)-binding oxidoreductase (.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0091 NAD_Ferredoxin PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Representative CDS sequence
>Lus10013488 pacid=23155078 polypeptide=Lus10013488 locus=Lus10013488.g ID=Lus10013488.BGIv1.0 annot-version=v1.0
ATGGGGAAAGGATTCGGAATCAATCAAATTGATCCGCCAGAGAAGTACTCTACCGTTCTGATTTTCGCTACCGGCTCTGGAATCAGTCCAATTCGATCTC
TAATTGAGACAGGGTTTAGTGCTGACCGAAGATCGGATGTGAGGCTTTACTATGGAGCTAGAAACCTTAAGAGGATGGCTTACCAGGATAGGTTCAAAGA
ATGGGAGTCGTCTGGTGTTAAGATTATTCCAGTACTATCGCAACCAGATGGTAGCTGGAAGGGTGAAGCTGGCTATGTACAGGCTGCTTTCGCTAGCGCC
ACGCAGATATCCAGCCCAGCAGGCACAGGTGCTGTGCTTTGTGGGCAGAAACAGATGGCAGAGGAGGTGACATCAATTCTTTTAGCAGAGGGAGTCTCCA
CAGACAGAATACTAAAGAACTTCTGA
AA sequence
>Lus10013488 pacid=23155078 polypeptide=Lus10013488 locus=Lus10013488.g ID=Lus10013488.BGIv1.0 annot-version=v1.0
MGKGFGINQIDPPEKYSTVLIFATGSGISPIRSLIETGFSADRRSDVRLYYGARNLKRMAYQDRFKEWESSGVKIIPVLSQPDGSWKGEAGYVQAAFASA
TQISSPAGTGAVLCGQKQMAEEVTSILLAEGVSTDRILKNF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G15140 FAD/NAD(P)-binding oxidoreduct... Lus10013488 0 1
AT5G63140 ATPAP29, PAP29 purple acid phosphatase 29 (.1... Lus10009863 2.2 0.8471
AT1G32500 ABCI7, ATNAP6 ATP-binding cassette I7, non-i... Lus10010168 3.6 0.9048
AT3G27320 alpha/beta-Hydrolases superfam... Lus10036931 6.2 0.8753
AT2G28940 Protein kinase superfamily pro... Lus10016536 6.9 0.8271
AT1G20225 Thioredoxin superfamily protei... Lus10017254 9.6 0.8561
AT2G23140 RING/U-box superfamily protein... Lus10011514 14.8 0.8312
AT3G62770 ATATG18A autophagy 18a, Transducin/WD40... Lus10015178 14.8 0.8326
AT1G31350 KUF1 KAR-UP F-box 1 (.1) Lus10033288 16.4 0.8075
AT5G64230 unknown protein Lus10010617 17.3 0.8118
AT5G15140 Galactose mutarotase-like supe... Lus10007251 17.7 0.8391

Lus10013488 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.