Lus10013498 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G73770 54 / 2e-09 unknown protein
AT3G18240 45 / 7e-06 Ribosomal protein S24/S35, mitochondrial (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007968 217 / 1e-73 AT1G73770 54 / 2e-09 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G046000 60 / 4e-12 AT1G73770 / unknown protein
Potri.015G044100 54 / 4e-09 AT3G18240 461 / 2e-161 Ribosomal protein S24/S35, mitochondrial (.1.2)
PFAM info
Representative CDS sequence
>Lus10013498 pacid=23155077 polypeptide=Lus10013498 locus=Lus10013498.g ID=Lus10013498.BGIv1.0 annot-version=v1.0
ATGAAAGGAACAACTCTGTTCAGAGCTTTCTCAGCCTCCACTCGAACCCTTTTCCGTACCAAACCCATCCAAACCCCCAAATCTCTAGTGATCGCTAGTT
ATGCTAATCCGACAACTCCAAGCCGGTTTTACTCGTCGGATTCATCGAGTAAACCAACACCCAGCCAGGTCGATAATCAGCCTGGTAATAATCCAGCAGT
TGAAGGCGTAGAAATCGTCAGCGATGAAGAGCTGAAAAGGCGCATCGAGAGATTCTACGACGGGGACGGCGACGCGATTCCATCGATTTTCGAAGCCATC
TTGGCGAGAAAGCTGGCTGGGGTGCACGACGATGAGAATCTGATGAAAGAGCTCCGGGAGAAGTTTCCGGCGGAGATAAATGGGAAGGACGGAGAAGTTT
CCGACTGGGATGATGACCTGGACGATGAAGAGGATGACGAGGATGATGATTAG
AA sequence
>Lus10013498 pacid=23155077 polypeptide=Lus10013498 locus=Lus10013498.g ID=Lus10013498.BGIv1.0 annot-version=v1.0
MKGTTLFRAFSASTRTLFRTKPIQTPKSLVIASYANPTTPSRFYSSDSSSKPTPSQVDNQPGNNPAVEGVEIVSDEELKRRIERFYDGDGDAIPSIFEAI
LARKLAGVHDDENLMKELREKFPAEINGKDGEVSDWDDDLDDEEDDEDDD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G73770 unknown protein Lus10013498 0 1
AT3G58660 Ribosomal protein L1p/L10e fam... Lus10005380 4.1 0.7922
AT5G27820 Ribosomal L18p/L5e family prot... Lus10031487 4.6 0.7214
AT5G62440 Protein of unknown function (D... Lus10021669 7.9 0.7622
AT1G73770 unknown protein Lus10007968 12.0 0.6286
AT4G25340 ATFKBP53 FK506 BINDING PROTEIN 53 (.1.2... Lus10031700 13.6 0.7380
AT5G27120 NOP56-like pre RNA processing ... Lus10033846 16.0 0.7253
AT1G78190 Trm112p-like protein (.1) Lus10032269 18.3 0.6676
AT1G54850 HSP20-like chaperones superfam... Lus10035725 18.8 0.7231
AT3G58660 Ribosomal protein L1p/L10e fam... Lus10024134 21.0 0.7145
AT1G70600 Ribosomal protein L18e/L15 sup... Lus10039528 24.1 0.7070

Lus10013498 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.