Lus10013499 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007969 71 / 4e-16 AT1G48745 57 / 3e-11 unknown protein
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10013499 pacid=23155083 polypeptide=Lus10013499 locus=Lus10013499.g ID=Lus10013499.BGIv1.0 annot-version=v1.0
ATGGAAGAAGAGACGTTACTGATCATGAGTAACCGCGAGCAGCAGGAAGATCAAAAGCCAGCCGCCAGCAAGGGAATCAAGAAGAAGAATCATCACAAGC
ACAAGTCCAAGAAGGCATCCGCATCGGCCTCAGCCTCGGCGGCGGCAGAGGAATCAGCTTCGTCGTCGTCTCCGCCGTCTTGTTCGTGCGGTAAGGCGGC
GGAGTACGGATGTAGCTGCTGTTTGTGCTGCGTGTATTGCCCTCTCTCGGTGGTGTCGTGCTGCGTGAAGTTGCCCTGTAAGGTTGGGATCAGAGCTGCA
CAGGCGGCGAAGAGGCAGTTAACTAATGGTGGTGGTGGTAGTGGAAGTAGTAGCGGTTGTTGGTCTTGTTGGAGGAAGAAGCCTTCTTACTACTATTCTT
CTTCGTTCTCCGATCTCGAATTCTCTCCGCCGTAG
AA sequence
>Lus10013499 pacid=23155083 polypeptide=Lus10013499 locus=Lus10013499.g ID=Lus10013499.BGIv1.0 annot-version=v1.0
MEEETLLIMSNREQQEDQKPAASKGIKKKNHHKHKSKKASASASASAAAEESASSSSPPSCSCGKAAEYGCSCCLCCVYCPLSVVSCCVKLPCKVGIRAA
QAAKRQLTNGGGGSGSSSGCWSCWRKKPSYYYSSSFSDLEFSPP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G48745 unknown protein Lus10013499 0 1
AT5G06060 NAD(P)-binding Rossmann-fold s... Lus10016498 3.2 0.7002
AT2G01150 RHA2B RING-H2 finger protein 2B (.1) Lus10003617 3.7 0.7069
AT1G61680 ATTPS14 terpene synthase 14 (.1.2) Lus10035240 7.3 0.6802
Lus10029487 13.6 0.6391
AT5G08300 Succinyl-CoA ligase, alpha sub... Lus10010185 24.0 0.6302
Lus10005752 28.3 0.6272
AT4G20280 TAF11 TBP-associated factor 11 (.1) Lus10038380 28.6 0.6054
AT4G21870 HSP20-like chaperones superfam... Lus10007666 34.2 0.6361
Lus10008493 36.2 0.6115
Lus10027443 37.7 0.6271

Lus10013499 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.