Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G33040 100 / 2e-28 Thioredoxin superfamily protein (.1) AT5G11930 82 / 2e-21 Thioredoxin superfamily protein (.1) AT4G15680 55 / 2e-11 Thioredoxin superfamily protein (.1) AT4G15660 54 / 1e-10 Thioredoxin superfamily protein (.1) AT4G15700 52 / 3e-10 Thioredoxin superfamily protein (.1) AT4G15690 52 / 3e-10 Thioredoxin superfamily protein (.1) AT1G28480 52 / 5e-10 roxy19, GRX480 Thioredoxin superfamily protein (.1) AT5G18600 51 / 1e-09 Thioredoxin superfamily protein (.1) AT4G15670 50 / 1e-09 Thioredoxin superfamily protein (.1) AT3G02000 51 / 2e-09 ROXY1 Thioredoxin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024982 [exp] 135 / 4e-42 AT4G33040 174 / 8e-57 Thioredoxin superfamily protein (.1) Lus10041538 [exp] 65 / 1e-14 AT5G14070 134 / 3e-41 Thioredoxin superfamily protein (.1) Lus10035183 [exp] 61 / 3e-13 AT5G14070 148 / 6e-47 Thioredoxin superfamily protein (.1) Lus10013962 [exp] 61 / 3e-13 AT1G28480 135 / 3e-42 Thioredoxin superfamily protein (.1) Lus10029440 [exp] 59 / 7e-13 AT3G62930 144 / 4e-46 Thioredoxin superfamily protein (.1) Lus10005940 [exp] 59 / 2e-12 AT3G62930 137 / 2e-43 Thioredoxin superfamily protein (.1) Lus10033965 [exp] 56 / 1e-11 AT5G18600 148 / 5e-48 Thioredoxin superfamily protein (.1) Lus10002887 [exp] 56 / 1e-11 AT4G15690 149 / 3e-48 Thioredoxin superfamily protein (.1) Lus10011333 [exp] 57 / 2e-11 AT5G14070 151 / 1e-47 Thioredoxin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G226900 [exp] 108 / 6e-32 AT4G33040 184 / 8e-61 Thioredoxin superfamily protein (.1) Potri.001G325800 [exp] 61 / 3e-13 AT3G02000 155 / 6e-50 Thioredoxin superfamily protein (.1) Potri.004G049800 [exp] 61 / 4e-13 AT1G28480 94 / 2e-25 Thioredoxin superfamily protein (.1) Potri.003G167000 [exp] 56 / 2e-11 AT5G14070 150 / 9e-48 Thioredoxin superfamily protein (.1) Potri.010G021800 [exp] 56 / 2e-11 AT5G18600 163 / 5e-54 Thioredoxin superfamily protein (.1) Potri.002G208700 [exp] 55 / 3e-11 AT3G62930 157 / 1e-51 Thioredoxin superfamily protein (.1) Potri.014G134000 [exp] 55 / 4e-11 AT3G62930 158 / 8e-52 Thioredoxin superfamily protein (.1) Potri.008G214500 [exp] 54 / 9e-11 AT3G21460 177 / 2e-59 Glutaredoxin family protein (.1) Potri.001G060600 [exp] 54 / 1e-10 AT5G14070 147 / 1e-46 Thioredoxin superfamily protein (.1) Potri.011G058800 [exp] 53 / 4e-10 AT1G28480 102 / 2e-28 Thioredoxin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [flax] [poplar] Thioredoxin PF00462 [flax] [poplar] Glutaredoxin Glutaredoxin
Representative CDS sequence Show only first row Show all	>Lus10013519 pacid=23178143 polypeptide=Lus10013519 locus=Lus10013519.g ID=Lus10013519.BGIv1.0 annot-version=v1.0 ATGCAAGGACTAGAGCTCTGTTCTAACGACGACGTCTGCCTCCGCCTCACCCCTCCTCCTCCGGCTCCCACCACCACCACATCTGCTTCTCTGTCAATCG ACGCCGTTGAATCAGCGGAGGACCGAATCCAGCGGCTGATATCAGAGAATCCGGTCATCATATTCTCCCGATCTTCCTGTTCTATGTGCCACGTCATGAA GAAACTTCTCGCCACAATCGGCGTCAATCCTACCGTCATCGAGTTGGAAGATCACGAGATCTCTGCTTTACCTTAA
AA sequence Show only first row Show all	>Lus10013519 pacid=23178143 polypeptide=Lus10013519 locus=Lus10013519.g ID=Lus10013519.BGIv1.0 annot-version=v1.0 MQGLELCSNDDVCLRLTPPPPAPTTTTSASLSIDAVESAEDRIQRLISENPVIIFSRSSCSMCHVMKKLLATIGVNPTVIELEDHEISALP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G33040			Thioredoxin superfamily protei...		Lus10013519 [exp]	0	1
AT1G27200			Domain of unknown function (DU...		Lus10013291 [exp]	1.7	0.9250
AT5G67140			F-box/RNI-like superfamily pro...		Lus10039564 [exp]	2.4	0.9247
AT1G06620			2-oxoglutarate (2OG) and Fe(II...		Lus10040380 [exp]	3.0	0.9123
AT1G20823			RING/U-box superfamily protein...		Lus10025162 [exp]	3.5	0.9048
AT5G43150			unknown protein		Lus10004910 [exp]	3.5	0.9109
AT2G39705		RTFL8, DVL11	DEVIL 11, ROTUNDIFOLIA like 8 ...		Lus10024323 [exp]	4.0	0.8775
AT1G20823			RING/U-box superfamily protein...		Lus10016040 [exp]	4.9	0.8926
AT2G16980			Major facilitator superfamily ...		Lus10023994 [exp]	6.0	0.8958
AT1G34060			Pyridoxal phosphate (PLP)-depe...		Lus10007085 [exp]	6.7	0.9097
AT1G15380		GLYI4	glyoxylase I 4, Lactoylglutath...		Lus10014269 [exp]	7.1	0.8763

Compare expression of checked genes

Lus10013519 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.