Lus10013544 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G22880 187 / 5e-62 HTB2, H2B HISTONE H2B, histone B2 (.1)
AT1G07790 186 / 8e-62 HTB1 Histone superfamily protein (.1)
AT3G46030 185 / 3e-61 HTB11 Histone superfamily protein (.1)
AT3G45980 185 / 3e-61 H2B, HTB9 HISTONE H2B, Histone superfamily protein (.1)
AT3G53650 183 / 2e-60 Histone superfamily protein (.1)
AT5G59910 182 / 7e-60 HTB4 Histone superfamily protein (.1)
AT2G28720 181 / 1e-59 Histone superfamily protein (.1)
AT2G37470 179 / 5e-59 Histone superfamily protein (.1)
AT5G02570 172 / 2e-56 Histone superfamily protein (.1)
AT3G09480 167 / 1e-54 Histone superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037371 190 / 3e-63 AT3G45980 233 / 3e-80 HISTONE H2B, Histone superfamily protein (.1)
Lus10041347 190 / 4e-63 AT3G45980 226 / 3e-77 HISTONE H2B, Histone superfamily protein (.1)
Lus10017292 189 / 5e-63 AT3G45980 226 / 2e-77 HISTONE H2B, Histone superfamily protein (.1)
Lus10005897 188 / 2e-62 AT3G45980 244 / 1e-84 HISTONE H2B, Histone superfamily protein (.1)
Lus10005893 188 / 2e-62 AT3G45980 234 / 8e-81 HISTONE H2B, Histone superfamily protein (.1)
Lus10016156 187 / 3e-62 AT3G45980 231 / 1e-79 HISTONE H2B, Histone superfamily protein (.1)
Lus10040855 186 / 1e-61 AT3G45980 247 / 2e-85 HISTONE H2B, Histone superfamily protein (.1)
Lus10017456 185 / 2e-61 AT2G28720 226 / 1e-77 Histone superfamily protein (.1)
Lus10023753 182 / 2e-60 AT2G37470 203 / 7e-69 Histone superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G029900 188 / 1e-62 AT1G07790 177 / 3e-58 Histone superfamily protein (.1)
Potri.010G230600 187 / 2e-62 AT1G07790 205 / 3e-69 Histone superfamily protein (.1)
Potri.010G230801 187 / 2e-62 AT1G07790 205 / 2e-69 Histone superfamily protein (.1)
Potri.010G231300 186 / 1e-61 AT1G07790 177 / 3e-58 Histone superfamily protein (.1)
Potri.008G030600 186 / 1e-61 AT5G59910 188 / 2e-62 Histone superfamily protein (.1)
Potri.004G091200 184 / 6e-61 AT5G02570 188 / 2e-62 Histone superfamily protein (.1)
Potri.010G230701 184 / 6e-61 AT5G59910 191 / 3e-63 Histone superfamily protein (.1)
Potri.009G028001 184 / 7e-61 AT5G02570 188 / 2e-62 Histone superfamily protein (.1)
Potri.017G123700 184 / 7e-61 AT5G02570 188 / 2e-62 Histone superfamily protein (.1)
Potri.004G091400 183 / 1e-60 AT2G28720 186 / 1e-61 Histone superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0012 Histone PF00125 Histone Core histone H2A/H2B/H3/H4
Representative CDS sequence
>Lus10013544 pacid=23168728 polypeptide=Lus10013544 locus=Lus10013544.g ID=Lus10013544.BGIv1.0 annot-version=v1.0
ATGGCGCCCAAGGCAGAGAAGAAACCAGCAGAGAAGAAGCAAGCGGAGAAAGCTCCTGTAGCCGAGAAGAAGCCCCGCGCGGAGAAGAAGCTCCCCAAGG
AAGGAGGAGCCGCCGGCGCGGACAAGAAGAAGAAGCGGAACAAGAAGAACGTCGAGACCTACAAGATCTACATCTTCAAGGTCCTGAAGCAGGTCCATCC
GGACATTGGGATCTCCAGCAAGGCTATGGGGATCATGAACAGCTTCATCAATGACATCTTCGAGAAGCTCGCTGCCGAGTCCTCCAGGCTTGCGAGGTAC
AACAAGAAGCCGACGATCACTTCTCGCGAGATCCAGACTGCCGTCAGGCTTGTTCTCCCCGGCGAGCTGGCGAAGCACGCTGTTTCTGAAGGGACCAAGG
CCGTCACCAAGTTTACCAGCTCTTAG
AA sequence
>Lus10013544 pacid=23168728 polypeptide=Lus10013544 locus=Lus10013544.g ID=Lus10013544.BGIv1.0 annot-version=v1.0
MAPKAEKKPAEKKQAEKAPVAEKKPRAEKKLPKEGGAAGADKKKKRNKKNVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAAESSRLARY
NKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G45980 H2B, HTB9 HISTONE H2B, Histone superfami... Lus10013544 0 1
AT3G53730 Histone superfamily protein (.... Lus10023331 1.0 0.9799
AT3G54560 HTA11 histone H2A 11 (.1) Lus10018753 1.4 0.9798
AT1G51060 HTA10 histone H2A 10 (.1) Lus10032464 2.2 0.9570
AT1G08880 HTA5 ,G-H2AX ,G... histone H2A 5, gamma histone v... Lus10028044 2.4 0.9621
AT5G59970 Histone superfamily protein (.... Lus10028464 2.8 0.9599
AT3G45980 H2B, HTB9 HISTONE H2B, Histone superfami... Lus10021408 4.2 0.9544
AT3G20260 Protein of unknown function (D... Lus10034809 6.2 0.9340
AT1G17140 RIP1, ICR1 ROP INTERACTIVE PARTNER 1, int... Lus10013708 7.4 0.9375
AT4G40030 Histone superfamily protein (.... Lus10013946 7.9 0.9413
AT4G13690 unknown protein Lus10000756 8.0 0.9417

Lus10013544 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.