Lus10013545 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016443 104 / 3e-28 AT5G14740 298 / 4e-101 CARBONIC ANHYDRASE 18, BETA CARBONIC ANHYDRASE 2, carbonic anhydrase 2 (.1.2.3.4.5)
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10013545 pacid=23168706 polypeptide=Lus10013545 locus=Lus10013545.g ID=Lus10013545.BGIv1.0 annot-version=v1.0
ATGAGGGGCAGGGCAAGGGTAGGGAAAAGAGGAGGAACAGGGGCAGCGAAAATGGGCAGCTGGGTTCTGGGAAGAGCTGTAGTGTCATTGTTAAAAGAAG
AAGAAGAAGAAGAAGAAGAAGATAGAATCATATTTGGAGGAAGCGCTGGACAAGGGGAGGGAGAGCAGCCCGTCGTCATCGCTGAACAGTCGGCGGTTAT
TTCAAATGGAATAGCAGGAAAAATTGGGTCGCCTAACGTCGTCGGCCGGGGATTGAATGGAAGCACGGAAACAGGGGCACTCATCGTCAACAACAGGGAG
TCAGGATATGCATGCAATTAA
AA sequence
>Lus10013545 pacid=23168706 polypeptide=Lus10013545 locus=Lus10013545.g ID=Lus10013545.BGIv1.0 annot-version=v1.0
MRGRARVGKRGGTGAAKMGSWVLGRAVVSLLKEEEEEEEEDRIIFGGSAGQGEGEQPVVIAEQSAVISNGIAGKIGSPNVVGRGLNGSTETGALIVNNRE
SGYACN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10013545 0 1
Lus10011061 2.2 1.0000
Lus10009800 4.0 1.0000
AT3G07740 HXA2, HXA02, HA... homolog of yeast ADA2 2A (.1.2... Lus10012337 5.9 1.0000
Lus10011496 6.2 1.0000
Lus10011848 6.9 1.0000
AT3G25050 XTH3 xyloglucan endotransglucosylas... Lus10011845 7.4 1.0000
AT5G46795 MSP2 microspore-specific promoter ... Lus10004566 7.7 1.0000
AT4G10020 ATHSD5 hydroxysteroid dehydrogenase 5... Lus10001280 8.0 1.0000
AT1G12570 Glucose-methanol-choline (GMC)... Lus10002957 8.5 1.0000
AT3G20760 Nse4, component of Smc5/6 DNA ... Lus10004185 8.9 1.0000

Lus10013545 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.