Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G36040 77 / 1e-19 J11 DnaJ11, Chaperone DnaJ-domain superfamily protein (.1) AT2G17880 72 / 1e-17 Chaperone DnaJ-domain superfamily protein (.1) AT3G13310 62 / 8e-14 Chaperone DnaJ-domain superfamily protein (.1) AT4G13830 48 / 5e-08 J20 DNAJ-like 20 (.1.2) AT2G33735 42 / 3e-06 Chaperone DnaJ-domain superfamily protein (.1) AT4G37480 42 / 6e-06 Chaperone DnaJ-domain superfamily protein (.1) AT1G28210 42 / 8e-06 ATJ1 DNAJ heat shock family protein (.1.2) AT4G39150 42 / 1e-05 DNAJ heat shock N-terminal domain-containing protein (.1.2) AT4G39960 41 / 2e-05 Molecular chaperone Hsp40/DnaJ family protein (.1) AT2G21510 41 / 2e-05 DNAJ heat shock N-terminal domain-containing protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017263 [exp] 134 / 9e-42 AT4G36040 106 / 2e-29 DnaJ11, Chaperone DnaJ-domain superfamily protein (.1) Lus10041906 [exp] 71 / 8e-17 AT4G36040 144 / 8e-45 DnaJ11, Chaperone DnaJ-domain superfamily protein (.1) Lus10028453 [exp] 70 / 1e-16 AT2G17880 146 / 2e-45 Chaperone DnaJ-domain superfamily protein (.1) Lus10025060 [exp] 62 / 5e-14 AT4G36040 102 / 7e-29 DnaJ11, Chaperone DnaJ-domain superfamily protein (.1) Lus10034484 [exp] 62 / 7e-14 AT4G36040 100 / 3e-28 DnaJ11, Chaperone DnaJ-domain superfamily protein (.1) Lus10032957 [exp] 60 / 4e-13 AT3G13310 109 / 2e-31 Chaperone DnaJ-domain superfamily protein (.1) Lus10002355 [exp] 51 / 4e-09 AT4G13830 139 / 2e-41 DNAJ-like 20 (.1.2) Lus10003150 [exp] 50 / 7e-09 AT4G13830 151 / 3e-46 DNAJ-like 20 (.1.2) Lus10019668 [exp] 50 / 7e-09 AT4G13830 82 / 6e-20 DNAJ-like 20 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G020700 [exp] 103 / 1e-29 AT2G17880 108 / 3e-30 Chaperone DnaJ-domain superfamily protein (.1) Potri.002G020800 [exp] 101 / 6e-29 AT2G17880 110 / 3e-31 Chaperone DnaJ-domain superfamily protein (.1) Potri.005G240700 [exp] 101 / 7e-29 AT2G17880 105 / 2e-29 Chaperone DnaJ-domain superfamily protein (.1) Potri.004G172300 [exp] 80 / 1e-20 AT2G17880 115 / 2e-33 Chaperone DnaJ-domain superfamily protein (.1) Potri.005G113100 [exp] 74 / 1e-18 AT2G17880 139 / 6e-43 Chaperone DnaJ-domain superfamily protein (.1) Potri.009G131800 [exp] 73 / 2e-18 AT2G17880 109 / 9e-32 Chaperone DnaJ-domain superfamily protein (.1) Potri.001G469600 [exp] 64 / 3e-14 AT3G13310 120 / 4e-35 Chaperone DnaJ-domain superfamily protein (.1) Potri.011G166500 [exp] 61 / 5e-13 AT3G13310 115 / 4e-33 Chaperone DnaJ-domain superfamily protein (.1) Potri.007G107600 [exp] 57 / 5e-12 AT3G13310 109 / 4e-31 Chaperone DnaJ-domain superfamily protein (.1) Potri.006G001301 [exp] 56 / 1e-11 AT3G13310 102 / 2e-28 Chaperone DnaJ-domain superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0392 [flax] [poplar] Chaperone-J PF00226 [flax] [poplar] DnaJ DnaJ domain
Representative CDS sequence Show only first row Show all	>Lus10013558 pacid=23168734 polypeptide=Lus10013558 locus=Lus10013558.g ID=Lus10013558.BGIv1.0 annot-version=v1.0 ATGGCAAGAGTCCTCCACCCGGACGTCGCCGGCGAGGATGATAGTACGGCGAGCGAGTTCATCAAATTGCACGAGGCGTACGAAACGCTTTCAGATCCGG AGAAACGGGCGGATTACGACCGGACTCTTTTCCGGGTGGGGCGGTCCATGAGCTATGCGTTTGTGATGTCGGCTGCGGCGTCGGGTTCGGGTCAGTCCGG GTACACTAGCCGAAGATGGGAAACGGATCAGTGCTGGTAG
AA sequence Show only first row Show all	>Lus10013558 pacid=23168734 polypeptide=Lus10013558 locus=Lus10013558.g ID=Lus10013558.BGIv1.0 annot-version=v1.0 MARVLHPDVAGEDDSTASEFIKLHEAYETLSDPEKRADYDRTLFRVGRSMSYAFVMSAAASGSGQSGYTSRRWETDQCW

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G36040		J11	DnaJ11, Chaperone DnaJ-domain ...		Lus10013558 [exp]	0	1
AT1G15670			Galactose oxidase/kelch repeat...		Lus10013538 [exp]	2.2	0.8490
AT4G36040		J11	DnaJ11, Chaperone DnaJ-domain ...		Lus10017263 [exp]	3.5	0.7780
AT4G37480			Chaperone DnaJ-domain superfam...		Lus10019286 [exp]	6.9	0.8123
AT4G28240			Wound-responsive family protei...		Lus10031617 [exp]	12.0	0.8182
AT1G15670			Galactose oxidase/kelch repeat...		Lus10017300 [exp]	14.3	0.8145
AT3G49940	AS2	LBD38	LOB domain-containing protein ...		Lus10011530 [exp]	16.9	0.7755
AT3G10220		EMB2804	EMBRYO DEFECTIVE 2804, tubulin...		Lus10026266 [exp]	18.2	0.7524
AT5G56550		ATOXS3	oxidative stress 3 (.1)		Lus10012939 [exp]	19.6	0.8117
AT1G79720			Eukaryotic aspartyl protease f...		Lus10024098 [exp]	20.8	0.7978
AT1G08570		ACHT4	atypical CYS HIS rich thiored...		Lus10026878 [exp]	21.9	0.7875

Compare expression of checked genes

Lus10013558 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.