Lus10013600 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G62980 157 / 1e-50 FOLB2 Dihydroneopterin aldolase (.1)
AT3G11750 157 / 2e-50 FOLB1 Dihydroneopterin aldolase (.1)
AT3G21730 134 / 5e-41 FOLB3 Dihydroneopterin aldolase (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021252 267 / 7e-94 AT5G62980 161 / 3e-52 Dihydroneopterin aldolase (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G067200 213 / 1e-72 AT3G11750 166 / 1e-53 Dihydroneopterin aldolase (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0334 THBO-biosyn PF02152 FolB Dihydroneopterin aldolase
Representative CDS sequence
>Lus10013600 pacid=23168741 polypeptide=Lus10013600 locus=Lus10013600.g ID=Lus10013600.BGIv1.0 annot-version=v1.0
ATGGAAGATCAAGAAGTAATCACTGGAGGAGATAAGCTTATACTAAGAGGGTTGAAGTTTCATGGTTTCCACGGAGTAAAACCGGAGGAAAGGTCGTTGG
GGCAGAAGTTTGTGATAGATGTAGATGCCTGGATGGATCTCCGACCAGCTGGCTTTTCTGATCAATTGGTAGACACCATTAGCTACACTGACATCTACCG
CATAGTTAAGGAAGTTGTGGAAGGGAAGCCACAGAACCTGCTGGAGACAGTGGCTCAAACTATTGCCATGACCACCTTGACGAAGCACGCTCGTATATCT
GCTGTGCGAGTGAAAGTTGAGAAGCCTCATGTTGCTGTTCATGGACCTATCGACTATCTCGGGGTTGAGATTCTCAGGCGTCGAGTTGTTGATCTGCCCA
AGTGA
AA sequence
>Lus10013600 pacid=23168741 polypeptide=Lus10013600 locus=Lus10013600.g ID=Lus10013600.BGIv1.0 annot-version=v1.0
MEDQEVITGGDKLILRGLKFHGFHGVKPEERSLGQKFVIDVDAWMDLRPAGFSDQLVDTISYTDIYRIVKEVVEGKPQNLLETVAQTIAMTTLTKHARIS
AVRVKVEKPHVAVHGPIDYLGVEILRRRVVDLPK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G11750 FOLB1 Dihydroneopterin aldolase (.1) Lus10013600 0 1
AT3G25210 Tetratricopeptide repeat (TPR)... Lus10038215 1.7 0.8987
AT2G41950 unknown protein Lus10016243 2.8 0.8726
AT1G20510 OPCL1 OPC-8:0 CoA ligase1 (.1.2) Lus10022336 10.4 0.8571
AT5G50090 unknown protein Lus10004229 12.1 0.8475
AT2G30942 Protein of unknown function (D... Lus10007167 12.2 0.8105
AT5G66530 Galactose mutarotase-like supe... Lus10041758 12.3 0.7891
AT4G23330 unknown protein Lus10024630 14.8 0.7530
AT1G61700 RNA polymerases N / 8 kDa subu... Lus10008095 15.7 0.8306
AT1G61700 RNA polymerases N / 8 kDa subu... Lus10025907 16.0 0.8026
AT3G11500 Small nuclear ribonucleoprotei... Lus10017019 16.3 0.8493

Lus10013600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.