Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G55340 83 / 1e-21 Protein of unknown function (DUF1639) (.1), Protein of unknown function (DUF1639) (.2) AT3G03880 63 / 6e-14 Protein of unknown function (DUF1639) (.1) AT4G20300 44 / 8e-07 Protein of unknown function (DUF1639) (.1), Protein of unknown function (DUF1639) (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010650 [exp] 105 / 5e-31 AT1G55340 148 / 3e-46 Protein of unknown function (DUF1639) (.1), Protein of unknown function (DUF1639) (.2) Lus10010312 [exp] 78 / 1e-19 AT1G55340 254 / 1e-86 Protein of unknown function (DUF1639) (.1), Protein of unknown function (DUF1639) (.2) Lus10036240 [exp] 39 / 0.0001 AT4G20300 217 / 3e-67 Protein of unknown function (DUF1639) (.1), Protein of unknown function (DUF1639) (.2) Lus10038379 [exp] 38 / 0.0001 AT4G20300 188 / 1e-58 Protein of unknown function (DUF1639) (.1), Protein of unknown function (DUF1639) (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G035300 [exp] 88 / 2e-23 AT1G55340 232 / 9e-78 Protein of unknown function (DUF1639) (.1), Protein of unknown function (DUF1639) (.2) Potri.001G004000 [exp] 86 / 8e-23 AT1G55340 268 / 4e-92 Protein of unknown function (DUF1639) (.1), Protein of unknown function (DUF1639) (.2) Potri.003G221000 [exp] 84 / 4e-22 AT1G55340 261 / 3e-89 Protein of unknown function (DUF1639) (.1), Protein of unknown function (DUF1639) (.2) Potri.013G057600 [exp] 80 / 4e-20 AT1G55340 212 / 1e-69 Protein of unknown function (DUF1639) (.1), Protein of unknown function (DUF1639) (.2) Potri.018G059200 [exp] 64 / 5e-14 AT1G55340 133 / 3e-38 Protein of unknown function (DUF1639) (.1), Protein of unknown function (DUF1639) (.2) Potri.006G233100 [exp] 60 / 1e-12 AT1G55340 130 / 9e-37 Protein of unknown function (DUF1639) (.1), Protein of unknown function (DUF1639) (.2) Potri.003G157500 [exp] 47 / 1e-07 AT4G20300 201 / 2e-61 Protein of unknown function (DUF1639) (.1), Protein of unknown function (DUF1639) (.2) Potri.001G073400 [exp] 47 / 1e-07 AT4G20300 226 / 3e-71 Protein of unknown function (DUF1639) (.1), Protein of unknown function (DUF1639) (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF07797 [flax] [poplar] DUF1639 Protein of unknown function (DUF1639)
Representative CDS sequence Show only first row Show all	>Lus10013616 pacid=23171605 polypeptide=Lus10013616 locus=Lus10013616.g ID=Lus10013616.BGIv1.0 annot-version=v1.0 ATGGCTATGAAAGGATGTAAGCTTCCTCAGAGACCCAAGAAGAGACCCAAACTCATCCAAAGAACCGTTCTTGCGGTGTGTCCCGGAGCATGGTTGACTG ATATGTGCCAAGAGAGATATGAAGTGAGAGAGAAGAAGAGTTCCAAGAAGAGACCAACAGGGCTGAAAGCAATGGGGAGTATGGATCATAGTGATTCAGA ATGA
AA sequence Show only first row Show all	>Lus10013616 pacid=23171605 polypeptide=Lus10013616 locus=Lus10013616.g ID=Lus10013616.BGIv1.0 annot-version=v1.0 MAMKGCKLPQRPKKRPKLIQRTVLAVCPGAWLTDMCQERYEVREKKSSKKRPTGLKAMGSMDHSDSE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G55340			Protein of unknown function (D...		Lus10013616 [exp]	0	1
AT1G63460		ATGPX8	glutathione peroxidase 8 (.1)		Lus10008023 [exp]	2.0	0.8883
					Lus10021189 [exp]	2.4	0.8948
AT1G21200	Trihelix		sequence-specific DNA binding ...		Lus10028581 [exp]	4.5	0.8872
AT1G23260		MMZ1 ,UEV1A	UBIQUITIN E2 VARIANT 1A, MMS Z...		Lus10021797 [exp]	5.2	0.8399
AT4G38360		LAZ1	LAZARUS 1, Protein of unknown ...		Lus10022626 [exp]	6.7	0.8880
AT5G58920			unknown protein		Lus10040699 [exp]	9.7	0.8489
AT3G12480	CCAAT	NF-YC11	"nuclear factor Y, subunit C11...		Lus10024082 [exp]	13.7	0.8511
AT2G42730			F-box family protein (.1.2)		Lus10028722 [exp]	15.2	0.8355
AT4G29430		RPS15AE	ribosomal protein S15A E (.1)		Lus10040543 [exp]	15.2	0.8575
AT4G39300			unknown protein		Lus10026340 [exp]	16.7	0.8173

Compare expression of checked genes

Lus10013616 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.