Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003863 [exp] 65 / 2e-15 ND 36 / 0.001
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10013622 pacid=23171625 polypeptide=Lus10013622 locus=Lus10013622.g ID=Lus10013622.BGIv1.0 annot-version=v1.0 ATGATCCAAAGTCAGCTAATAAACAGCAGATACGCCATAGCAAATGTTCTTCAGAATTCCCAGCAACAGCAGCAGCAAGTTGCAATGCTCCAGCCAGCAT ACTCCAACAACTCCTCTGCTTCTACCAACCTCCTTAACCTTGCTAGCTTCAACACCTCCAACTTCGACCTCCCCCCGAATCCTGCTCCTCCTGTCGACGA AGAAAGCTGCATTCCAACTACTTTCCCCGACGGCATCCTTCGTCCAAGATGA
AA sequence Show only first row Show all	>Lus10013622 pacid=23171625 polypeptide=Lus10013622 locus=Lus10013622.g ID=Lus10013622.BGIv1.0 annot-version=v1.0 MIQSQLINSRYAIANVLQNSQQQQQQVAMLQPAYSNNSSASTNLLNLASFNTSNFDLPPNPAPPVDEESCIPTTFPDGILRPR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10013622 [exp]	0	1
AT3G51710			D-mannose binding lectin prote...		Lus10009088 [exp]	1.0	0.8263
AT3G51710			D-mannose binding lectin prote...		Lus10025259 [exp]	4.0	0.8229
AT4G05400			copper ion binding (.1.2)		Lus10031070 [exp]	5.7	0.7649
AT1G64610			Transducin/WD40 repeat-like su...		Lus10017312 [exp]	7.5	0.8190
AT4G19380			Long-chain fatty alcohol dehyd...		Lus10037257 [exp]	9.2	0.7887
AT2G19130			S-locus lectin protein kinase ...		Lus10039732 [exp]	12.6	0.7880
AT5G03810			GDSL-like Lipase/Acylhydrolase...		Lus10035590 [exp]	14.2	0.7777
AT5G17820			Peroxidase superfamily protein...		Lus10020311 [exp]	14.5	0.7420
AT2G34930			disease resistance family prot...		Lus10029483 [exp]	15.9	0.7601
AT2G35605			SWIB/MDM2 domain superfamily p...		Lus10034774 [exp]	18.3	0.7074

Compare expression of checked genes

Lus10013622 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.