Lus10013649 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002510 56 / 7e-11 ND /
Lus10043173 56 / 2e-10 ND /
Lus10003639 40 / 0.0002 ND /
Lus10030099 37 / 0.0007 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10013649 pacid=23171617 polypeptide=Lus10013649 locus=Lus10013649.g ID=Lus10013649.BGIv1.0 annot-version=v1.0
ATGACAGAAACCATCTCTTTTTACTTCCTGGCAAAGGTGGCAACTGCTTGGACAAGAATTAAGAGAACGGTGAACAATCCCTGGCCTTTCAAAATAAAGA
ACAGGGGGGAAGTTGAGAACCAGTTGACCTCAGTCTCTTATGACTCGGTTAAAGACATCTTCGAAGAAGGGCCAACTGGGAACATCCAAGACCCGGCAGA
AACTAGGGTTCACAACGATCCATGTGACTGGGCTGAGCTGCTGACTCCGAATGCATCCCAAGATCTGCAAGAGAGACCGCAACGCAGACAGACGGAAGAT
AGTGACAAGCTGGAAGAGGAAAGCGAGGAGGGCAATGTAGTTCAGGGAGAAGATGGTGACAAGCTGGAAGAGGAAAATGAGGATGGCAACACAGTGTAG
AA sequence
>Lus10013649 pacid=23171617 polypeptide=Lus10013649 locus=Lus10013649.g ID=Lus10013649.BGIv1.0 annot-version=v1.0
MTETISFYFLAKVATAWTRIKRTVNNPWPFKIKNRGEVENQLTSVSYDSVKDIFEEGPTGNIQDPAETRVHNDPCDWAELLTPNASQDLQERPQRRQTED
SDKLEEESEEGNVVQGEDGDKLEEENEDGNTV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10013649 0 1
Lus10013650 1.0 0.9389
AT1G08030 AQC1, TPST active quiescent center1, tyro... Lus10016093 2.0 0.8909
AT2G25660 EMB2410 embryo defective 2410 (.1) Lus10012414 2.8 0.8363
Lus10039764 3.0 0.8603
AT3G55960 Haloacid dehalogenase-like hyd... Lus10040202 3.2 0.8280
AT5G11100 SYT4, NTMCTYPE2... synaptotagmin 4, Calcium-depen... Lus10041034 6.3 0.8125
AT5G18580 FASS2, TON2, GD... GORDO, FASS 1, EMBRYO DEFECTIV... Lus10002884 6.9 0.7683
AT1G75790 SKS18 SKU5 similar 18 (.1) Lus10038672 7.7 0.7981
Lus10022938 8.5 0.8220
AT1G13570 F-box/RNI-like superfamily pro... Lus10020638 9.5 0.7586

Lus10013649 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.