Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G68090 43 / 7e-06 ANN5, ANNAT5 ANNEXIN ARABIDOPSIS THALIANA 5, annexin 5 (.1) AT2G38760 40 / 8e-05 ANN3, ANNAT3 annexin 3 (.1) AT5G12380 40 / 0.0001 ANNAT8 annexin 8 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010666 [exp] 150 / 6e-46 AT5G12380 118 / 6e-31 annexin 8 (.1) Lus10024054 [exp] 45 / 2e-06 AT5G65020 400 / 6e-141 annexin 2 (.1.2) Lus10041696 [exp] 44 / 4e-06 AT5G65020 395 / 2e-138 annexin 2 (.1.2) Lus10039550 [exp] 43 / 1e-05 AT2G38760 323 / 2e-109 annexin 3 (.1) Lus10009225 [exp] 42 / 2e-05 AT1G68090 358 / 3e-124 ANNEXIN ARABIDOPSIS THALIANA 5, annexin 5 (.1) Lus10024172 [exp] 42 / 2e-05 AT2G38760 349 / 1e-120 annexin 3 (.1) Lus10037992 [exp] 42 / 3e-05 AT1G68090 321 / 6e-110 ANNEXIN ARABIDOPSIS THALIANA 5, annexin 5 (.1) Lus10023530 [exp] 41 / 4e-05 AT1G68090 350 / 4e-121 ANNEXIN ARABIDOPSIS THALIANA 5, annexin 5 (.1) Lus10036470 [exp] 38 / 0.0005 AT1G35720 406 / 3e-143 annexin 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G055000 [exp] 76 / 1e-17 AT5G12380 144 / 1e-40 annexin 8 (.1) Potri.001G024800 [exp] 45 / 2e-06 AT2G38760 395 / 1e-138 annexin 3 (.1) Potri.008G139500 [exp] 43 / 7e-06 AT1G68090 363 / 4e-126 ANNEXIN ARABIDOPSIS THALIANA 5, annexin 5 (.1) Potri.001G277500 [exp] 41 / 3e-05 AT5G12380 442 / 3e-157 annexin 8 (.1) Potri.003G200700 [exp] 37 / 0.001 AT5G12380 399 / 3e-140 annexin 8 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10013654 pacid=23171577 polypeptide=Lus10013654 locus=Lus10013654.g ID=Lus10013654.BGIv1.0 annot-version=v1.0 ATGGCCGAGTTGTTATCTATATGGATAGCTGATCCGATTGAACGCGATCCTGCCATTGCCGGGAGGGCTCTTTTCGGATACAAGTCATCATGTGCTAGTA CTTTACATGCCCCAAACTTCAAGGTCGTGGTTGAGATATTCGTGGGTCGAAAATCTAGTCATGTTGCTATGATAAAACGAGCTTACCTTGCGAGGTTCAG GTCGCAGCTTGAGCATGATGTTATGAGCCTCGAGCCCTCTAGTCCGCACCAGAAGCTTTGGATGCATCCCACGAGGCTCACCATGTTGACCAGAGGTGGC TCAAGAGGCTCTGTTGCTTGA
AA sequence Show only first row Show all	>Lus10013654 pacid=23171577 polypeptide=Lus10013654 locus=Lus10013654.g ID=Lus10013654.BGIv1.0 annot-version=v1.0 MAELLSIWIADPIERDPAIAGRALFGYKSSCASTLHAPNFKVVVEIFVGRKSSHVAMIKRAYLARFRSQLEHDVMSLEPSSPHQKLWMHPTRLTMLTRGG SRGSVA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10013654 [exp]	0	1
AT5G16080		ATCXE17	carboxyesterase 17 (.1)		Lus10002019 [exp]	2.0	0.9669
AT2G27410	B3		Domain of unknown function (DU...		Lus10027284 [exp]	3.0	0.9717
AT5G45890		SAG12	senescence-associated gene 12 ...		Lus10003275 [exp]	4.2	0.9387
AT3G46140			Protein kinase superfamily pro...		Lus10029018 [exp]	4.7	0.9532
AT5G15430			Plant calmodulin-binding prote...		Lus10003472 [exp]	5.3	0.9699
AT5G03610			GDSL-like Lipase/Acylhydrolase...		Lus10028145 [exp]	6.5	0.9687
AT4G26110		NAP1;1, ATNAP1;...	ARABIDOPSIS THALIANA NUCLEOSOM...		Lus10042106 [exp]	6.8	0.9342
AT5G37810		NIP4;1, NLM4	NOD26-LIKE MIP 4, NOD26-like i...		Lus10016703 [exp]	7.7	0.8958
AT1G24540		CYP86C1	"cytochrome P450, family 86, s...		Lus10006232 [exp]	8.1	0.9471
AT4G18210		ATPUP10	purine permease 10 (.1)		Lus10026130 [exp]	8.9	0.8782

Compare expression of checked genes

Lus10013654 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.