Lus10013657 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G17486 243 / 2e-81 PPPDE putative thiol peptidase family protein (.1.2)
AT5G47310 224 / 1e-73 PPPDE putative thiol peptidase family protein (.1)
AT1G47740 216 / 3e-70 PPPDE putative thiol peptidase family protein (.1.2)
AT5G25170 204 / 3e-66 PPPDE putative thiol peptidase family protein (.1)
AT2G25190 195 / 1e-62 PPPDE putative thiol peptidase family protein (.1)
AT1G80690 190 / 9e-61 PPPDE putative thiol peptidase family protein (.1)
AT4G31980 196 / 1e-58 unknown protein
AT4G25680 84 / 2e-19 PPPDE putative thiol peptidase family protein (.1)
AT4G25660 82 / 2e-18 PPPDE putative thiol peptidase family protein (.1)
AT3G07090 68 / 2e-13 PPPDE putative thiol peptidase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033030 436 / 2e-157 AT4G17486 225 / 3e-74 PPPDE putative thiol peptidase family protein (.1.2)
Lus10043293 357 / 2e-126 AT4G17486 243 / 3e-81 PPPDE putative thiol peptidase family protein (.1.2)
Lus10019437 350 / 2e-123 AT4G17486 241 / 1e-80 PPPDE putative thiol peptidase family protein (.1.2)
Lus10040170 241 / 8e-81 AT4G17486 283 / 9e-98 PPPDE putative thiol peptidase family protein (.1.2)
Lus10004755 227 / 3e-75 AT4G17486 273 / 2e-93 PPPDE putative thiol peptidase family protein (.1.2)
Lus10007844 223 / 2e-73 AT4G17486 277 / 3e-95 PPPDE putative thiol peptidase family protein (.1.2)
Lus10032708 212 / 7e-69 AT1G47740 357 / 1e-125 PPPDE putative thiol peptidase family protein (.1.2)
Lus10004372 219 / 9e-69 AT5G47310 244 / 1e-77 PPPDE putative thiol peptidase family protein (.1)
Lus10003951 210 / 2e-68 AT1G47740 358 / 8e-126 PPPDE putative thiol peptidase family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G070600 334 / 1e-117 AT4G17486 235 / 1e-78 PPPDE putative thiol peptidase family protein (.1.2)
Potri.006G154400 325 / 6e-114 AT4G17486 220 / 8e-73 PPPDE putative thiol peptidase family protein (.1.2)
Potri.003G080300 253 / 1e-85 AT5G47310 295 / 9e-102 PPPDE putative thiol peptidase family protein (.1)
Potri.001G154400 252 / 4e-85 AT5G47310 308 / 4e-107 PPPDE putative thiol peptidase family protein (.1)
Potri.002G134200 216 / 1e-70 AT1G47740 346 / 3e-121 PPPDE putative thiol peptidase family protein (.1.2)
Potri.004G151200 213 / 2e-69 AT1G47740 335 / 1e-116 PPPDE putative thiol peptidase family protein (.1.2)
Potri.018G021700 212 / 2e-69 AT5G25170 301 / 2e-104 PPPDE putative thiol peptidase family protein (.1)
Potri.014G042300 212 / 5e-69 AT1G47740 339 / 2e-118 PPPDE putative thiol peptidase family protein (.1.2)
Potri.T126004 209 / 4e-68 AT1G47740 337 / 2e-117 PPPDE putative thiol peptidase family protein (.1.2)
Potri.009G113168 208 / 1e-67 AT1G47740 335 / 6e-117 PPPDE putative thiol peptidase family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0125 Peptidase_CA PF05903 Peptidase_C97 PPPDE putative peptidase domain
Representative CDS sequence
>Lus10013657 pacid=23171606 polypeptide=Lus10013657 locus=Lus10013657.g ID=Lus10013657.BGIv1.0 annot-version=v1.0
ATGGAGGTTGGAATCGCCTCGGTGAATACGAGCTCCGGGAAGGAGAATTTGAACGATAGCGGTGGAACCCTTGTGGTTCTGAATGTCTACGATCTCACCC
CTGTCAACAATTATGCTTATTGGTTCGGTTTCGGAATCTTCCATTCTGGCATTGAAGTTCATGGCAAGGAGTATGGATTTGGAGCTCATGATTTCCCAGT
TAGTGGAGTTTTTGAAGTTGAGCCAAGAAACTGCCCAGGTTTCATTTACAGAAGTTCCATCCCACTGGGCCACATAACGATGCCTCCTACCGAGTTCAGG
ACGTTTATAGAGAGCATGGCTTCTGAGTATCATGGAGATACTTACCACCTTATCTCCAAGAACTGCAACCATTTTACCGATGACGTATGCTCCAGGCTGA
CTGGAAAGAAAATACCAGGATTCGTGAATCGGCTTGCCCGGCTAGGAGCTCTGTGCAGTTGTTTGCTTCCTGAAAGCCTTCAAGTGACTACAGTGAAACA
GCTGCCTGAACACCATGACTTGTTGGAAGAAGATGGAAGCAACTCGCAGACATCAGCCACCTTAACCAATGACTCAACGGAAATCGAAGATATAGAACAA
GAGAGGCACCTGCTGTCACCAAGCCGTGGAGCGGGAGAAGTGTCATTTGTGAAAGAAAGAAGTCCAACGGAAGATAAGCTACTTCATTGA
AA sequence
>Lus10013657 pacid=23171606 polypeptide=Lus10013657 locus=Lus10013657.g ID=Lus10013657.BGIv1.0 annot-version=v1.0
MEVGIASVNTSSGKENLNDSGGTLVVLNVYDLTPVNNYAYWFGFGIFHSGIEVHGKEYGFGAHDFPVSGVFEVEPRNCPGFIYRSSIPLGHITMPPTEFR
TFIESMASEYHGDTYHLISKNCNHFTDDVCSRLTGKKIPGFVNRLARLGALCSCLLPESLQVTTVKQLPEHHDLLEEDGSNSQTSATLTNDSTEIEDIEQ
ERHLLSPSRGAGEVSFVKERSPTEDKLLH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G17486 PPPDE putative thiol peptidase... Lus10013657 0 1
AT4G25050 ACP4 acyl carrier protein 4 (.1.2) Lus10018986 1.4 0.9358
AT1G67550 URE urease (.1) Lus10015814 2.0 0.9351
AT4G32140 EamA-like transporter family (... Lus10006194 3.9 0.9324
AT3G27530 MAG4, GC6 MAIGO 4, golgin candidate 6 (.... Lus10032089 4.0 0.9312
AT1G55510 BCDH BETA1, BCD... branched-chain alpha-keto acid... Lus10010324 6.9 0.9093
Lus10025502 7.0 0.9282
AT5G53070 Ribosomal protein L9/RNase H1 ... Lus10022383 7.3 0.9154
AT4G14410 bHLH bHLH104 basic Helix-Loop-Helix 104, ba... Lus10022186 8.1 0.9287
AT3G46060 ARA3, Ara-3, At... RAB GTPase homolog 8A (.1.2.3) Lus10024423 8.3 0.9093
AT3G54010 DEI1, PAS1 PASTICCINO 1, FKBP-type peptid... Lus10021502 8.4 0.9238

Lus10013657 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.