Lus10013658 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020424 51 / 4e-09 ND /
Lus10030369 47 / 3e-07 ND /
Lus10004787 47 / 5e-07 ND /
Lus10036281 47 / 7e-07 ND /
Lus10011701 47 / 1e-06 ND /
Lus10011788 44 / 2e-06 ND /
Lus10013509 44 / 2e-06 ND /
Lus10020955 41 / 1e-05 ND /
Lus10032967 40 / 4e-05 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10013658 pacid=23171588 polypeptide=Lus10013658 locus=Lus10013658.g ID=Lus10013658.BGIv1.0 annot-version=v1.0
ATGTCGAAGAACCAGCAGTTGGAGGACCTACAGCAGTTTTTACGAAGTCACCATTCCACTTGGATGATTGACACAATCAGATTGAGTGTAGTTCATGCTG
CATATCCTAAGTACAGCACGGGACAGTGGGTAAGTGGCAGTGAGCTGAAGTTTGGTCTCAATCAAGTCTCACTCAACTATGCTTTTGAATGTTACAGACT
TACAATGATTCTATGCTTAAACTCAGATCCTATTCAGATGCTGTCTCAATCTCATGCATCGACTGACAGGAGTTTCGATCCTCATCCAAGGCACCAGAGA
TGCTCCGTTCACACGTTCTCCAAGGTAAAACAGGCGGGAGGAGTCCGAATGAGGTTGCTAGAAAAATGTCGTGGGGATTTGGTTGCAATCGAAACACGCA
GGGCGACCCTAGTGGTTTGCCGTCTTCCCTACCTTTATGAGGCTCGGGGCGTGGGTCGGAGACTGGTTACTTCCGAGTCCGGCTGA
AA sequence
>Lus10013658 pacid=23171588 polypeptide=Lus10013658 locus=Lus10013658.g ID=Lus10013658.BGIv1.0 annot-version=v1.0
MSKNQQLEDLQQFLRSHHSTWMIDTIRLSVVHAAYPKYSTGQWVSGSELKFGLNQVSLNYAFECYRLTMILCLNSDPIQMLSQSHASTDRSFDPHPRHQR
CSVHTFSKVKQAGGVRMRLLEKCRGDLVAIETRRATLVVCRLPYLYEARGVGRRLVTSESG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10013658 0 1
AT5G67360 ARA12 Subtilase family protein (.1) Lus10027891 4.1 1.0000
Lus10026042 5.1 1.0000
Lus10027530 6.9 1.0000
Lus10002313 7.4 1.0000
AT5G56790 Protein kinase superfamily pro... Lus10000773 8.0 1.0000
AT1G69530 ATHEXPALPHA1.2,... EXPANSIN 1, expansin A1 (.1.2.... Lus10003438 9.8 1.0000
Lus10006296 10.6 1.0000
Lus10012669 11.0 1.0000
AT5G49900 Beta-glucosidase, GBA2 type fa... Lus10023340 11.3 1.0000
Lus10013504 11.5 1.0000

Lus10013658 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.