Lus10013660 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G20050 141 / 8e-41 Protein kinase superfamily protein (.1)
AT5G35370 45 / 4e-06 S-locus lectin protein kinase family protein (.1)
AT4G32300 44 / 1e-05 SD2-5 S-domain-2 5 (.1)
AT5G48740 43 / 3e-05 Leucine-rich repeat protein kinase family protein (.1)
AT1G34300 42 / 9e-05 lectin protein kinase family protein (.1)
AT3G53590 40 / 0.0002 Leucine-rich repeat protein kinase family protein (.1)
AT1G63430 39 / 0.0005 Leucine-rich repeat protein kinase family protein (.1.2)
AT5G40380 39 / 0.0009 CRK42 cysteine-rich RLK (RECEPTOR-like protein kinase) 42 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033032 223 / 6e-72 AT5G20050 483 / 4e-169 Protein kinase superfamily protein (.1)
Lus10002917 49 / 4e-07 AT4G32300 950 / 0.0 S-domain-2 5 (.1)
Lus10000249 48 / 6e-07 AT4G32300 949 / 0.0 S-domain-2 5 (.1)
Lus10028067 43 / 3e-05 AT5G35370 844 / 0.0 S-locus lectin protein kinase family protein (.1)
Lus10025617 42 / 6e-05 AT5G35370 469 / 2e-156 S-locus lectin protein kinase family protein (.1)
Lus10031229 41 / 6e-05 AT4G11890 58 / 2e-10 Protein kinase superfamily protein (.1.2.3.4)
Lus10008486 42 / 7e-05 AT1G63430 878 / 0.0 Leucine-rich repeat protein kinase family protein (.1.2)
Lus10001489 42 / 8e-05 AT1G63430 879 / 0.0 Leucine-rich repeat protein kinase family protein (.1.2)
Lus10029553 42 / 8e-05 AT5G10530 591 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G070800 154 / 1e-45 AT5G20050 516 / 0.0 Protein kinase superfamily protein (.1)
Potri.011G003900 57 / 4e-10 AT5G38280 413 / 1e-135 PR5-like receptor kinase (.1)
Potri.004G014250 54 / 5e-09 AT1G70250 364 / 5e-115 receptor serine/threonine kinase, putative (.1)
Potri.004G014200 54 / 5e-09 AT5G38280 392 / 5e-128 PR5-like receptor kinase (.1)
Potri.004G014301 54 / 6e-09 AT4G32300 312 / 9e-98 S-domain-2 5 (.1)
Potri.004G014450 53 / 9e-09 AT4G32300 316 / 9e-99 S-domain-2 5 (.1)
Potri.004G014512 52 / 2e-08 AT5G38280 469 / 1e-157 PR5-like receptor kinase (.1)
Potri.004G014700 52 / 2e-08 AT5G38280 457 / 3e-153 PR5-like receptor kinase (.1)
Potri.018G027300 50 / 1e-07 AT4G32300 1012 / 0.0 S-domain-2 5 (.1)
Potri.011G004000 49 / 4e-07 AT4G32300 277 / 2e-82 S-domain-2 5 (.1)
PFAM info
Representative CDS sequence
>Lus10013660 pacid=23171590 polypeptide=Lus10013660 locus=Lus10013660.g ID=Lus10013660.BGIv1.0 annot-version=v1.0
ATGGAGAACAAGACTGTCAACATCCTAGCCTGCTCCACAATCACCTTACTCCTCATCATCATAATCGTCGCCCGAGTCTCCCTCAACCTCTCCCGAACTT
TCTTCTTCATCGCCGGCGCCGATGTCGCCGTAATCCTCGCCGTCTTCTCCTGCCTCCTTATCAGGCGCCGCTACAATAACAGGAGCAAAATCCTCCAGAC
TCAAATGGTCTCCGAAAACAAAGAGCTACGCATCGAGTACAGCTTCCTCCGCAAAGTCGCTGGCGTTCCCACCAAGTTCCGGCACCAAGAACTCGAGGAC
GCCACCGAAAACTTCAAATCCTTTCTCGGAAGAGGATCCTCTGCTTCGGTCTTCAAAGGCGTGTTGAAACTCTACTTCGGTCGTCAAAGGCGTGTTGTAA
GGCGGGAAGGAAGTGGCTGTGAAGCGGATCGGGGCGGAAGAAAAGGGTGA
AA sequence
>Lus10013660 pacid=23171590 polypeptide=Lus10013660 locus=Lus10013660.g ID=Lus10013660.BGIv1.0 annot-version=v1.0
MENKTVNILACSTITLLLIIIIVARVSLNLSRTFFFIAGADVAVILAVFSCLLIRRRYNNRSKILQTQMVSENKELRIEYSFLRKVAGVPTKFRHQELED
ATENFKSFLGRGSSASVFKGVLKLYFGRQRRVVRREGSGCEADRGGRKG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G20050 Protein kinase superfamily pro... Lus10013660 0 1
AT5G20050 Protein kinase superfamily pro... Lus10013659 10.4 0.7217
AT5G47840 AMK2 adenosine monophosphate kinase... Lus10009477 18.8 0.7146
AT3G12570 FYD FYD (.1.2.3.4) Lus10023420 26.0 0.6262
AT2G33490 hydroxyproline-rich glycoprote... Lus10001808 27.4 0.6368
AT4G33270 AtCDC20.1, CDC2... cell division cycle 20.1, Tran... Lus10043009 47.5 0.6411
AT1G72020 unknown protein Lus10009443 54.7 0.6145
AT3G53810 Concanavalin A-like lectin pro... Lus10004982 65.2 0.6194
Lus10021106 103.0 0.5922
AT5G63440 Protein of unknown function (D... Lus10022455 132.8 0.5710
AT2G48020 Major facilitator superfamily ... Lus10042676 174.7 0.5582

Lus10013660 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.