Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G19070 49 / 5e-09 F-box family protein (.1) AT4G13960 51 / 9e-09 F-box/RNI-like superfamily protein (.1) AT1G67390 51 / 1e-08 F-box family protein (.1) AT1G16930 50 / 2e-08 F-box/RNI-like/FBD-like domains-containing protein (.1) AT2G42720 48 / 1e-07 FBD, F-box, Skp2-like and Leucine Rich Repeat domains containing protein (.1) AT1G55660 48 / 1e-07 FBD, F-box and Leucine Rich Repeat domains containing protein (.1.2) AT4G22280 48 / 1e-07 F-box/RNI-like superfamily protein (.1.2) AT5G22700 48 / 1e-07 F-box/RNI-like/FBD-like domains-containing protein (.1) AT1G47915 45 / 1e-07 F-box family protein (.1) AT2G42730 48 / 2e-07 F-box family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028558 [exp] 51 / 3e-09 AT3G51530 56 / 4e-10 F-box/RNI-like/FBD-like domains-containing protein (.1) Lus10035669 [exp] 49 / 1e-08 AT3G58880 55 / 8e-10 F-box/RNI-like superfamily protein (.1) Lus10004851 [exp] 50 / 2e-08 AT1G13570 139 / 7e-37 F-box/RNI-like superfamily protein (.1) Lus10020292 [exp] 49 / 9e-08 AT1G60410 76 / 9e-15 F-box family protein (.1) Lus10024696 [exp] 48 / 1e-07 AT5G22720 75 / 1e-14 F-box/RNI-like superfamily protein (.1.2) Lus10037289 [exp] 48 / 1e-07 AT5G02920 61 / 4e-10 F-box/RNI-like superfamily protein (.1) Lus10024695 [exp] 47 / 2e-07 AT1G69630 83 / 3e-17 F-box/RNI-like superfamily protein (.1) Lus10005091 [exp] 47 / 2e-07 AT1G69010 149 / 5e-41 BES1-interacting Myc-like protein 2 (.1) Lus10028722 [exp] 47 / 3e-07 AT2G42730 76 / 1e-14 F-box family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G106600 [exp] 49 / 7e-08 AT5G56420 80 / 4e-16 F-box/RNI-like/FBD-like domains-containing protein (.1.2) Potri.004G224975 [exp] 47 / 4e-07 AT5G53840 48 / 4e-06 F-box/RNI-like/FBD-like domains-containing protein (.1) Potri.011G104100 [exp] 46 / 6e-07 AT3G26922 96 / 2e-22 F-box/RNI-like superfamily protein (.1) Potri.011G104300 [exp] 45 / 1e-06 AT3G26922 91 / 2e-20 F-box/RNI-like superfamily protein (.1) Potri.011G024600 [exp] 45 / 2e-06 AT4G26350 95 / 9e-21 F-box/RNI-like/FBD-like domains-containing protein (.1) Potri.011G104200 [exp] 44 / 3e-06 AT3G26922 97 / 2e-22 F-box/RNI-like superfamily protein (.1) Potri.015G011200 [exp] 44 / 3e-06 AT4G03220 90 / 1e-19 Protein with RNI-like/FBD-like domains (.1) Potri.015G002100 [exp] 44 / 5e-06 AT4G03220 103 / 5e-24 Protein with RNI-like/FBD-like domains (.1) Potri.001G337200 [exp] 43 / 9e-06 AT5G22660 86 / 6e-19 FBD, F-box, Skp2-like and Leucine Rich Repeat domains containing protein (.1.2) Potri.015G002001 [exp] 42 / 1e-05 AT2G04230 59 / 9e-10 FBD, F-box and Leucine Rich Repeat domains containing protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0271 [flax] [poplar] F-box PF00646 [flax] [poplar] F-box F-box domain
Representative CDS sequence Show only first row Show all	>Lus10013664 pacid=23171585 polypeptide=Lus10013664 locus=Lus10013664.g ID=Lus10013664.BGIv1.0 annot-version=v1.0 ATGACGAAAAGCCTCTGGACAGCTCTCGCTATTCCTTCACAGCAGCAGGGTTCTGCCAAGAAATGTGACAATTCAAGTGACCGAATCAGTGAGCTAAGTG ATGAAGTCCTCCTGTATATTCTGTCTTTGTTGACACTTAAGCAGGCCGCTGCCACTAGCATTCTTTCCACTCGTTGGAGGAACTTGTGGCATCCATACCT TGCCTCGACTTTAATGCTGCAACAACCCCTGCGAGAAGAGCTAGATTTTGAGAGCTGCTTGAAGACGAAAGGTCCACATATGTCAGATAATCTAATCAAC AACTAG
AA sequence Show only first row Show all	>Lus10013664 pacid=23171585 polypeptide=Lus10013664 locus=Lus10013664.g ID=Lus10013664.BGIv1.0 annot-version=v1.0 MTKSLWTALAIPSQQQGSAKKCDNSSDRISELSDEVLLYILSLLTLKQAAATSILSTRWRNLWHPYLASTLMLQQPLREELDFESCLKTKGPHMSDNLIN N

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G67390			F-box family protein (.1)		Lus10013664 [exp]	0	1
AT3G10850		GLY2, GLX2-2	GLYOXALASE 2-2, Metallo-hydrol...		Lus10029004 [exp]	2.6	0.8860
AT2G17787			unknown protein		Lus10013567 [exp]	7.9	0.8840
AT5G10620			methyltransferases (.1)		Lus10026980 [exp]	8.1	0.8674
AT4G01310			Ribosomal L5P family protein (...		Lus10010251 [exp]	8.9	0.8532
AT2G17900		ASHR1, SDG37	ASH1-related 1, SET domain gro...		Lus10029712 [exp]	9.2	0.8743
					Lus10014678 [exp]	9.9	0.8841
AT1G07745		SSN1, ATRAD51D,...	SUPPRESOR OF SNI1, homolog of ...		Lus10005437 [exp]	11.6	0.8822
AT1G69010	bHLH	bHLH102, BIM2	BES1-interacting Myc-like prot...		Lus10005091 [exp]	13.4	0.8827
AT2G17787			unknown protein		Lus10017274 [exp]	14.7	0.8751
AT2G27790			RNA-binding (RRM/RBD/RNP motif...		Lus10030600 [exp]	15.5	0.8738

Compare expression of checked genes

Lus10013664 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.