Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G67750 107 / 9e-29 Pectate lyase family protein (.1) AT5G63180 102 / 5e-27 Pectin lyase-like superfamily protein (.1) AT3G27400 99 / 8e-26 Pectin lyase-like superfamily protein (.1) AT4G24780 99 / 2e-25 Pectin lyase-like superfamily protein (.1.2) AT4G13710 89 / 1e-21 Pectin lyase-like superfamily protein (.1.2) AT1G04680 84 / 3e-20 Pectin lyase-like superfamily protein (.1) AT3G24230 77 / 1e-17 Pectate lyase family protein (.1) AT3G24670 75 / 6e-17 Pectin lyase-like superfamily protein (.1) AT3G07010 74 / 9e-17 Pectin lyase-like superfamily protein (.1) AT4G13210 74 / 1e-16 Pectin lyase-like superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033037 [exp] 120 / 1e-33 AT5G63180 671 / 0.0 Pectin lyase-like superfamily protein (.1) Lus10022310 [exp] 105 / 6e-28 AT5G63180 626 / 0.0 Pectin lyase-like superfamily protein (.1) Lus10014887 [exp] 102 / 7e-27 AT5G63180 620 / 0.0 Pectin lyase-like superfamily protein (.1) Lus10036946 [exp] 95 / 5e-24 AT5G63180 627 / 0.0 Pectin lyase-like superfamily protein (.1) Lus10023679 [exp] 91 / 1e-22 AT4G13710 729 / 0.0 Pectin lyase-like superfamily protein (.1.2) Lus10011400 [exp] 91 / 2e-22 AT1G67750 623 / 0.0 Pectate lyase family protein (.1) Lus10006456 [exp] 89 / 7e-22 AT1G67750 625 / 0.0 Pectate lyase family protein (.1) Lus10022817 [exp] 83 / 1e-19 AT3G24670 673 / 0.0 Pectin lyase-like superfamily protein (.1) Lus10011758 [exp] 82 / 2e-19 AT4G13710 703 / 0.0 Pectin lyase-like superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G087800 [exp] 118 / 6e-33 AT5G63180 657 / 0.0 Pectin lyase-like superfamily protein (.1) Potri.001G339500 [exp] 117 / 2e-32 AT4G24780 617 / 0.0 Pectin lyase-like superfamily protein (.1.2) Potri.012G091500 [exp] 117 / 2e-32 AT4G24780 645 / 0.0 Pectin lyase-like superfamily protein (.1.2) Potri.010G051800 [exp] 113 / 9e-31 AT1G67750 645 / 0.0 Pectate lyase family protein (.1) Potri.008G182200 [exp] 111 / 2e-30 AT1G67750 671 / 0.0 Pectate lyase family protein (.1) Potri.001G052300 [exp] 89 / 5e-22 AT4G13710 696 / 0.0 Pectin lyase-like superfamily protein (.1.2) Potri.003G175900 [exp] 89 / 6e-22 AT4G13710 681 / 0.0 Pectin lyase-like superfamily protein (.1.2) Potri.008G032700 [exp] 80 / 1e-18 AT5G04310 556 / 0.0 Pectin lyase-like superfamily protein (.1) Potri.002G238800 [exp] 76 / 2e-17 AT3G07010 655 / 0.0 Pectin lyase-like superfamily protein (.1) Potri.006G122000 [exp] 76 / 3e-17 AT3G53190 647 / 0.0 Pectin lyase-like superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10013666 pacid=23171568 polypeptide=Lus10013666 locus=Lus10013666.g ID=Lus10013666.BGIv1.0 annot-version=v1.0 ATGGGTTATCCCACATTGCTCTTCTTCTTCTTCTCCATCCTTTCCTCTTTCCTTTCCTCTTCCCTCATTTACTCCTCCCATGTCCATGATCCTGAGCTCG TTGTACAAGAGGTACATCGGGCAATCAATGAGTCAAGGAGGAATCTAGGCTACTTATCATGCGGGTCAGGCAACCCGATCGACGACTGCTGGAGGTGCGA CCCCAACTGGGAAAAGAACCGACAACGTCTAGCAGACTGCGCCATCGGCTTTCGGAGAAAAGTGCTTCGGCAAAAACGCAATCGGCGGCAGGGACGGCAG GATCTACGTGGTCACCGACTCAAACGACAACGACGTCGTTAA
AA sequence Show only first row Show all	>Lus10013666 pacid=23171568 polypeptide=Lus10013666 locus=Lus10013666.g ID=Lus10013666.BGIv1.0 annot-version=v1.0 MGYPTLLFFFFSILSSFLSSSLIYSSHVHDPELVVQEVHRAINESRRNLGYLSCGSGNPIDDCWRCDPNWEKNRQRLADCAIGFRRKVLRQKRNRRQGRQ DLRGHRLKRQRRR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G24780			Pectin lyase-like superfamily ...		Lus10013666 [exp]	0	1
AT5G64740		PRC1, IXR2, E11...	PROCUSTE 1, ISOXABEN RESISTANT...		Lus10003525 [exp]	4.0	0.8894
AT1G19835			Plant protein of unknown funct...		Lus10024324 [exp]	8.8	0.8871
AT2G25790			Leucine-rich receptor-like pro...		Lus10006045 [exp]	8.8	0.8132
AT1G77380		AAP3, ATAAP3	amino acid permease 3 (.1)		Lus10042744 [exp]	9.2	0.8497
AT5G47490			RGPR-related (.1)		Lus10008520 [exp]	9.4	0.8829
AT1G66830			Leucine-rich repeat protein ki...		Lus10017611 [exp]	9.5	0.8730
AT5G63180			Pectin lyase-like superfamily ...		Lus10013667 [exp]	9.6	0.8476
AT1G61680		ATTPS14	terpene synthase 14 (.1.2)		Lus10018392 [exp]	9.8	0.8663
AT1G15690		FUGU5, AtVHP1;1...	FUGU 5, ARABIDOPSIS THALIANA V...		Lus10038114 [exp]	10.0	0.8817
AT1G69530		ATHEXPALPHA1.2,...	EXPANSIN 1, expansin A1 (.1.2....		Lus10036763 [exp]	10.0	0.8313

Compare expression of checked genes

Lus10013666 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.