Lus10013672 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10013672 pacid=23171602 polypeptide=Lus10013672 locus=Lus10013672.g ID=Lus10013672.BGIv1.0 annot-version=v1.0
ATGTTGATATTGGAGGGTCCCCTTTATGTGTTGGGAGCAGTACCTCAACATCGAGCCACATGCAGACTCCTAGCAACGACCACTACTAAGAAAAAACAGA
GAGTTTTGGAGCTGTCAATCTGTGGACTGTGGCCATCATCATCCATCAAGTTTTGGTGCGAGTACTGTAGGGTTAGATCAAGAGTTGATGTGCTGAACTG
A
AA sequence
>Lus10013672 pacid=23171602 polypeptide=Lus10013672 locus=Lus10013672.g ID=Lus10013672.BGIv1.0 annot-version=v1.0
MLILEGPLYVLGAVPQHRATCRLLATTTTKKKQRVLELSICGLWPSSSIKFWCEYCRVRSRVDVLN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10013672 0 1
Lus10008440 1.0 0.9617
AT3G18040 ATMPK9 MAP kinase 9 (.1.2) Lus10027248 2.0 0.8876
AT5G62420 NAD(P)-linked oxidoreductase s... Lus10031739 6.3 0.8340
AT5G62420 NAD(P)-linked oxidoreductase s... Lus10031162 7.3 0.8252
AT2G01570 GRAS RGA1 REPRESSOR OF GA1-3 1, REPRESSO... Lus10018098 8.5 0.8698
AT4G05220 Late embryogenesis abundant (L... Lus10007636 9.6 0.7360
AT4G20820 FAD-binding Berberine family p... Lus10023376 12.2 0.8427
Lus10024160 13.0 0.7477
AT3G26040 HXXXD-type acyl-transferase fa... Lus10036126 15.0 0.8098
Lus10033534 16.5 0.8222

Lus10013672 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.